Catalog name Description price
R-C-5751 DSPE-PEG2000-MbCD DSPE-PEG-MbCD,MβCD is a cyclic oligosaccharide molecule that can form inclusion complexes with hydrophobic guest molecules. By conjugating MβCD to DSPE-PEG, the resulting DSPE-PEG-MβCD conjugate can enhance the solubility and stability of hydrophobic drugs or imaging agents.The incorporation of MβCD in DSPE-PEG-MβCD allows for the formation of liposomal systems that can encapsulate and deliver hydrophobic drugs, solubilize hydrophobic imaging agents, or promote the cellular uptake of hydrophobic compounds. price>
R-C-5756 DSPE-PEG2000-SKPPGTSSC (SKP) DSPE-PEG-SKPPGTSSC (SKP),DSPE is a phospholipid that is commonly used in the formulation of liposomes or lipid-based drug delivery systems.PEG is a hydrophilic polymer that is often conjugated to molecules to enhance their stability, increase solubility, and extend circulation time in the body. PEGylation can improve the bioavailability and reduce the immunogenicity of drug delivery systems.DSPE-PEG-SKPPGTSSC can be modified to incorporate additional functionalities or payloads, such as fluorescent dyes or therapeutic agents, to enable targeted and specific delivery to desired cells or tissues. price>
R-C-5759 DSPE-PEG2000-Peptide-22(Ac-C(&)MPRLRGC(&)-NH2) Phospholipid polyethylene glycol peptides are a type of commonly used nano delivery system materials in the biomedical field. They are typically composed of phosphatidylcholine, polyethylene glycol, and peptides with specific affinity. Among them, phosphatidylcholine can provide structural support and targeted carriers, while polyethylene glycol can increase the cycling time and biocompatibility of the material in vivo, reduce its immunogenicity, and peptide sequences can provide specific binding and targeting to specific target molecules. price>
R-C-5760 DSPE-PEG2000-THR DSPE-PEG-threonine,DSPE is a phospholipid commonly used in the formulation of liposomes or lipid-based drug delivery systems. It provides stability and allows for integration into the lipid bilayer.PEG is a hydrophilic polymer that is often conjugated to molecules to enhance their stability, increase solubility, and extend circulation time in the body.THR or threonine, is an amino acid.Threonine is a polar amino acid that is often found in the active sites of enzymes and can play a role in protein structure and function. price>
R-C-5765 DSPE-PEG-5HT DSPE-PEG-5-hydroxytryptamine,The DSPE-PEG-5-hydroxytryptamine nanoparticle formulation can be utilized in various biomedical applications. For example, it could be used for targeted drug delivery, where the nanoparticles encapsulate therapeutic agents and specifically deliver them to cells expressing serotonin receptors. Additionally, the formulation could also be used for diagnostic purposes by incorporating imaging agents, allowing for targeted imaging of specific tissues or cells. price>
R-C-5770 (ASPSerser6)DSPE-PEG2000-COOH DSPE-PEG(2000) Carboxylic Acid,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-PEG-succinic acid (DSPE-PEG-COOH), (or N-succinyl-L-α-phosphatidylethanolamine, Distearoyl) is a DSPE-PEG conjugate with carboxylic acid group at the end of PEG. DSPE-PEG-COOH is used to prepare long-circulating liposomes with free COOH on the surface for further modification of peptides and other functional groups (ASPSserser6). This product is only suitable for scientific research and does not require clinical or human experimentation. price>
R-C-5771 DSPE-PEG2000-CLP003 DSPE-PEG-CLP003,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.This product is only suitable for scientific research and does not require clinical or human experimentation. price>
R-C-5772 DSPE-PEG2000-CLP003-FITC DSPE-PEG-CLP003-FITC,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.FITC is a commonly used fluorescent dye that emits green fluorescence when excited by a specific wavelength of light. By attaching FITC to the DSPE-PEG2000-CLP003 conjugate, it allows for visualization and tracking of the conjugate in biological systems.This product is only suitable for scientific research and does not require clinical or human experimentation. price>
R-C-5778 DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. price>
R-C-5789 DSPE-PEG2000-KKKKKKKKKK DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions. price>