Catalog |
name |
Description |
price |
R-C-5759 |
DSPE-PEG2000-Peptide-22(Ac-C(&)MPRLRGC(&)-NH2) |
Phospholipid polyethylene glycol peptides are a type of commonly used nano delivery system materials in the biomedical field. They are typically composed of phosphatidylcholine, polyethylene glycol, and peptides with specific affinity. Among them, phosphatidylcholine can provide structural support and targeted carriers, while polyethylene glycol can increase the cycling time and biocompatibility of the material in vivo, reduce its immunogenicity, and peptide sequences can provide specific binding and targeting to specific target molecules. |
price> |
R-C-5760 |
DSPE-PEG2000-THR |
DSPE-PEG-threonine,DSPE is a phospholipid commonly used in the formulation of liposomes or lipid-based drug delivery systems. It provides stability and allows for integration into the lipid bilayer.PEG is a hydrophilic polymer that is often conjugated to molecules to enhance their stability, increase solubility, and extend circulation time in the body.THR or threonine, is an amino acid.Threonine is a polar amino acid that is often found in the active sites of enzymes and can play a role in protein structure and function. |
price> |
R-C-5765 |
DSPE-PEG-5HT |
DSPE-PEG-5-hydroxytryptamine,The DSPE-PEG-5-hydroxytryptamine nanoparticle formulation can be utilized in various biomedical applications. For example, it could be used for targeted drug delivery, where the nanoparticles encapsulate therapeutic agents and specifically deliver them to cells expressing serotonin receptors. Additionally, the formulation could also be used for diagnostic purposes by incorporating imaging agents, allowing for targeted imaging of specific tissues or cells. |
price> |
R-C-5770 |
(ASPSerser6)DSPE-PEG2000-COOH |
DSPE-PEG(2000) Carboxylic Acid,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-PEG-succinic acid (DSPE-PEG-COOH), (or N-succinyl-L-α-phosphatidylethanolamine, Distearoyl) is a DSPE-PEG conjugate with carboxylic acid group at the end of PEG. DSPE-PEG-COOH is used to prepare long-circulating liposomes with free COOH on the surface for further modification of peptides and other functional groups (ASPSserser6). This product is only suitable for scientific research and does not require clinical or human experimentation. |
price> |
R-C-5771 |
DSPE-PEG2000-CLP003 |
DSPE-PEG-CLP003,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.This product is only suitable for scientific research and does not require clinical or human experimentation. |
price> |
R-C-5772 |
DSPE-PEG2000-CLP003-FITC |
DSPE-PEG-CLP003-FITC,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.FITC is a commonly used fluorescent dye that emits green fluorescence when excited by a specific wavelength of light. By attaching FITC to the DSPE-PEG2000-CLP003 conjugate, it allows for visualization and tracking of the conjugate in biological systems.This product is only suitable for scientific research and does not require clinical or human experimentation. |
price> |
R-C-5778 |
DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT |
DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. |
price> |
R-C-5789 |
DSPE-PEG2000-KKKKKKKKKK |
DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions. |
price> |
R-C-5795 |
mPEG2K-SS-PEI1.8K-DPSE |
DPSE-PEI-SS-MPEG,MPEG-SS-PEI-DPSE is a commonly used construct for gene vectors and drug loaded nanoparticles in the biomedical field.In this compound,the mPEG and SS functional groups provide biocompatibility and stability.The presence of PEI can cause it to condense with negatively charged biological molecules such as DNA,making it a gene carrier. |
price> |
R-C-5797 |
DSPE-PEG2000-OCH3 |
DSPE-PEG-OCH3,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems such as liposomes and lipid nanoparticles.PEGylation can improve the stability and circulation time of the nanoparticles by reducing interactions with proteins and immune recognition.This can lead to improved drug delivery efficiency and reduced clearance rates.The methoxy group (-OCH3) at the end of the PEG chain in DSPE-PEG-OCH3 is often used as a spacer between the nanoparticle surface and any targeting ligands or functional moieties that may be attached. The methoxy group can provide flexibility and prevent steric hindrance, allowing for effective conjugation of targeting ligands or other molecules. |
price> |