Home > products > phospholipids
> phospholipid-peg-customization
> dspe-peg2000-sslgwwgprrdfpgrreriylgipwlsllgsgapspv-rhodamine-b
DSPE-PEG2000-SSLGWWGPRRDFPGRRERIYLGIPWLSLLGSGAPSPV-Rhodamine B
1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-SSLGWWGPRRDFPGRRERIYLGIPWLSLLGSGAPSPV-Rhodamine B
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-C-5645 | 20mg | 2520.00 | + Add to cart |
|
|
Product description
Rhodamine B is a synthetic chemical and a dye. Rhodamine dyes are also widely used in biotechnology such as fluorescence microscopy, flow cytometry, fluorescence related spectroscopy, and enzyme-linked immunosorbent assay.DSPE is a lipid with good biocompatibility and near-infrared imaging ability,which can be used for the preparation of drug loaded nanoparticles.PEG chains can improve the stability and cycling time of materials in living organisms.DSPE-PEG can couple multiple functional groups,peptides,etc.
Appearance | N/A |
---|---|
PEG Molecular weight | 2000 |
purity | >95% |
PDI by GPC | <1.5 |
Storage | -20℃ protected from light and moisture |
Transportation | 4-25℃temperature for up to 3 weeks |
Stability | 1year |
Document
Related Product