Catalog name Description price
R-C-5772 DSPE-PEG2000-CLP003-FITC DSPE-PEG-CLP003-FITC,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.FITC is a commonly used fluorescent dye that emits green fluorescence when excited by a specific wavelength of light. By attaching FITC to the DSPE-PEG2000-CLP003 conjugate, it allows for visualization and tracking of the conjugate in biological systems.This product is only suitable for scientific research and does not require clinical or human experimentation. price>
R-C-5778 DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. price>
R-C-5789 DSPE-PEG2000-KKKKKKKKKK DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions. price>
R-C-5795 mPEG2K-SS-PEI1.8K-DPSE DPSE-PEI-SS-MPEG,MPEG-SS-PEI-DPSE is a commonly used construct for gene vectors and drug loaded nanoparticles in the biomedical field.In this compound,the mPEG and SS functional groups provide biocompatibility and stability.The presence of PEI can cause it to condense with negatively charged biological molecules such as DNA,making it a gene carrier. price>
R-C-5797 DSPE-PEG2000-OCH3 DSPE-PEG-OCH3,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems such as liposomes and lipid nanoparticles.PEGylation can improve the stability and circulation time of the nanoparticles by reducing interactions with proteins and immune recognition.This can lead to improved drug delivery efficiency and reduced clearance rates.The methoxy group (-OCH3) at the end of the PEG chain in DSPE-PEG-OCH3 is often used as a spacer between the nanoparticle surface and any targeting ligands or functional moieties that may be attached. The methoxy group can provide flexibility and prevent steric hindrance, allowing for effective conjugation of targeting ligands or other molecules. price>
R-C-5800 DSPE-PEG2K-PBP(CDAEWVDVS) DSPE-PEG-PBP,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems,providing stability and structure to the nanoparticles.PEGylation involves attaching PEG chains to the molecule,offering improved stability, circulation time, and reduced immunogenicity.The peptide sequence PBP(CDAEWVDVS) is attached to the PEG chain. price>
R-C-5801 DSPE-PEG2K-VHPKQHR DSPE-PEG-VHPKQHR,By adding a cysteine group to the N-terminus of VHPKQHR peptide, a VCAM-1-binding peptide derived from phage display in vivo85,the linkage of CVHPKQHR to distearoyl phosphoethanolamine-poly(ethylene glycol) 2000-maleimide (DSPE-PEG2000-maleimide) was facilitated through thioether linkage,forming DSPE-PEG2000-VHPKQHR. price>
R-C-5832 DSPE-PEG-GGGGK(TAMRA)TILVSRSTQTGRRRRRRRR DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a lipid molecule that can be incorporated into lipid bilayers, such as liposomes. It provides stability and structure to lipid-based nanostructures.PEG (polyethylene glycol) is a biocompatible and hydrophilic polymer that is often attached to lipids to improve the stability, circulation time, and biocompatibility of liposomes.TAMRA is a commonly used fluorescent dye that can be conjugated to peptides(TILVSRSTQTGRRRRRRRR)or other biomolecules for visualization purposes. price>
R-C-5833 DSPE-PEG350-GGGGK(TAMRA)TILVSRSTQTGRRRRRRRR DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a lipid molecule that can be incorporated into lipid bilayers, such as liposomes. It provides stability and structure to lipid-based nanostructures.PEG (polyethylene glycol) is a biocompatible and hydrophilic polymer that is often attached to lipids to improve the stability, circulation time, and biocompatibility of liposomes.TAMRA is a commonly used fluorescent dye that can be conjugated to peptides(TILVSRSTQTGRRRRRRRR)or other biomolecules for visualization purposes.The molecular weight of PEGs varies. price>
R-C-5835 GGGGK(TAMRA)TILVSRSTQTGRRRRRRRR-PEG750-DSPE DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a lipid molecule that can be incorporated into lipid bilayers, such as liposomes. It provides stability and structure to lipid-based nanostructures.PEG (polyethylene glycol) is a biocompatible and hydrophilic polymer that is often attached to lipids to improve the stability, circulation time, and biocompatibility of liposomes.TAMRA is a commonly used fluorescent dye that can be conjugated to peptides(TILVSRSTQTGRRRRRRRR)or other biomolecules for visualization purposes.The molecular weight of PEGs varies. price>