Product phospholipids -phospholipid-peg-customization

Home > products > phospholipids > phospholipid-peg-customization

Catalog	name	Description	price
R-C-5778	DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT	DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.	price>
R-C-5789	DSPE-PEG2000-KKKKKKKKKK	DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions.	price>
R-C-5795	mPEG2K-SS-PEI1.8K-DPSE	DPSE-PEI-SS-MPEG,MPEG-SS-PEI-DPSE is a commonly used construct for gene vectors and drug loaded nanoparticles in the biomedical field.In this compound,the mPEG and SS functional groups provide biocompatibility and stability.The presence of PEI can cause it to condense with negatively charged biological molecules such as DNA,making it a gene carrier.	price>
R-C-5797	DSPE-PEG2000-OCH3	DSPE-PEG-OCH3,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems such as liposomes and lipid nanoparticles.PEGylation can improve the stability and circulation time of the nanoparticles by reducing interactions with proteins and immune recognition.This can lead to improved drug delivery efficiency and reduced clearance rates.The methoxy group (-OCH3) at the end of the PEG chain in DSPE-PEG-OCH3 is often used as a spacer between the nanoparticle surface and any targeting ligands or functional moieties that may be attached. The methoxy group can provide flexibility and prevent steric hindrance, allowing for effective conjugation of targeting ligands or other molecules.	price>
R-C-5800	DSPE-PEG2K-PBP(CDAEWVDVS)	DSPE-PEG-PBP,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems,providing stability and structure to the nanoparticles.PEGylation involves attaching PEG chains to the molecule,offering improved stability, circulation time, and reduced immunogenicity.The peptide sequence PBP(CDAEWVDVS) is attached to the PEG chain.	price>
R-C-5801	DSPE-PEG2K-VHPKQHR	DSPE-PEG-VHPKQHR,By adding a cysteine group to the N-terminus of VHPKQHR peptide, a VCAM-1-binding peptide derived from phage display in vivo85,the linkage of CVHPKQHR to distearoyl phosphoethanolamine-poly(ethylene glycol) 2000-maleimide (DSPE-PEG2000-maleimide) was facilitated through thioether linkage,forming DSPE-PEG2000-VHPKQHR.	price>
R-C-5832	DSPE-PEG-GGGGK(TAMRA)TILVSRSTQTGRRRRRRRR	DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a lipid molecule that can be incorporated into lipid bilayers, such as liposomes. It provides stability and structure to lipid-based nanostructures.PEG (polyethylene glycol) is a biocompatible and hydrophilic polymer that is often attached to lipids to improve the stability, circulation time, and biocompatibility of liposomes.TAMRA is a commonly used fluorescent dye that can be conjugated to peptides（TILVSRSTQTGRRRRRRRR）or other biomolecules for visualization purposes.	price>
R-C-5833	DSPE-PEG350-GGGGK(TAMRA)TILVSRSTQTGRRRRRRRR	DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a lipid molecule that can be incorporated into lipid bilayers, such as liposomes. It provides stability and structure to lipid-based nanostructures.PEG (polyethylene glycol) is a biocompatible and hydrophilic polymer that is often attached to lipids to improve the stability, circulation time, and biocompatibility of liposomes.TAMRA is a commonly used fluorescent dye that can be conjugated to peptides（TILVSRSTQTGRRRRRRRR）or other biomolecules for visualization purposes.The molecular weight of PEGs varies.	price>
R-C-5835	GGGGK(TAMRA)TILVSRSTQTGRRRRRRRR-PEG750-DSPE	DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a lipid molecule that can be incorporated into lipid bilayers, such as liposomes. It provides stability and structure to lipid-based nanostructures.PEG (polyethylene glycol) is a biocompatible and hydrophilic polymer that is often attached to lipids to improve the stability, circulation time, and biocompatibility of liposomes.TAMRA is a commonly used fluorescent dye that can be conjugated to peptides（TILVSRSTQTGRRRRRRRR）or other biomolecules for visualization purposes.The molecular weight of PEGs varies.	price>
R-C-5840	DSPE-PEG2K-NGR-10R	DSPE-PEG-NGR-10R refers to a compound containing DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine) as a lipid anchor, PEG2K (polyethylene glycol with a molecular weight of 2000) as a spacer, NGR (Asn-Gly-Arg) as a targeting peptide sequence, and 10R as a modification.PEG is commonly used as a spacer to improve the solubility, stability, and biocompatibility of the compound, as well as to reduce immunogenicity.NGR: NGR is a peptide sequence composed of Asparagine (N), Glycine (G), and Arginine (R).	price>

...