Product phospholipids -phospholipid-peg-customization

Home > products > phospholipids > phospholipid-peg-customization

Catalog	name	Description	price
R-C-7139	DSPE-PEG-TK-COOH	COOH-TK-PEG-DSPE,DSPE-PEG-TK-COOH is a reactive oxygen species(ROS)responsive biomaterial,provided with membrane compatibility by phospholipids(DSPE),Thioketal(TK)as ROS sensitive breakpoints,polyethylene glycol(PEG)to prolong cycling time,and carboxyl groups(COOH)for functional modification.	price>
R-C-7141	DSPE-PEG-PGA	DSPE-PEG-PGA,PGA-PEG-DSPE,DSPE-PEG-PGA is a multifunctional lipid polymer conjugate widely used in nanomedicine delivery systems.The hydrophobic phospholipid DSPE binds with hydrophilic PEG chains to form an amphiphilic structure,which can self assemble into micelles or liposomes in water.Polyglutamic acid is commonly used as a drug carrier or biodegradable material,with a hydrophobic core function	price>
R-C-7146	DSPE-PEG-CKGGRAKDC	CKGGRAKDC-PEG-DSPE,The adipose tissue homing peptide sequence CKGGRAKDC is a targeted peptide composed of 9 amino acids.After phosphatidylation modification, DSPE-PEG-CKGGRAKDC can be used to make micelles,and the liposomes formed by vesicles can directly act on tumor targets,forming an active targeting effect.	price>
R-C-7164	DSPE-PEG-HEME	DSPE-PEG2000-HEME,DSPE-PEG-Hematoporphyrin Monomethyl Ether (DSPE-PEG-HMME)is a complex formed by modifying Hematoporphyrin Monomethyl Ether(HMME)with phospholipid molecules(DSPE)and polyethylene glycol(PEG),mainly used in the construction of drug delivery systems.Hemoporphyrin monomethyl ether(PheoA)is a porphyrin photosensitizer that can absorb visible light(especially 660-680 nm)and produce reactive oxygen species upon excitation.	price>
R-C-7173	DSPE-PEG-neutravidin	DSPE-PEG-neutravidin,DSPE PEG NutrAvidin is a functionalized amphiphilic molecule that can be coupled with targeted ligands such as RGD peptides and trastuzumab to achieve precise delivery by specifically binding to tumor cell surface receptors such as HER2 and integrins.NeutrAvidin is a specially treated affinity protein mainly used in fields such as biotin labeling detection and protein purification.	price>
R-C-7174	DSPE-PEG-r9-RGD(Arg-Gly-Asp)	RGD-r9-PEG-DSPE,DSPE-PEG-R9-RGD is a functional molecule composed of phospholipids(DSPE),polyethylene glycol(PEG),and r9,RGD peptides.It has an amphiphilic structure,and r9 peptide can enhance cell uptake,improve drug efficacy,and reduce side effects.RGD(Arg-Gly-Asp)is an integrin targeting peptide that can specifically bind to integrin receptors on the surface of tumor cells or vascular endothelial cells(such as α v β 3 and α v β 5),endowing the material with active targeting ability.	price>
R-C-7180	DOPE-PEG2000-EDTA	DOPE-PEG-EDTA,DOPE-PEG-Ethylenediaminetetraacetic acid,The hydrophobic end DOPE is easy to insert into lipid matrices or hydrophobic microdomains,while the hydrophilic end PEG extends into the aqueous phase,forming a spatial protective layer. The EDTA group modified at the end endows the material with selective chelating ability towards multivalent metal cations.	price>
R-C-7181	DSPE-PEG2000-EDTA	DSPE-PEG-EDTA,EDTA refers to ethylenediaminetetraacetic acid,a commonly used metal ion chelating agent.DSPE-PEG-EDTA is a functionalized lipid material that utilizes the chelating ability of EDTA to bind or clear specific metal ions,or to construct responsive drug carriers.Its core advantage lies in the ability to construct drug delivery systems with targeting,long circulation,and stability.	price>
R-C-7198	DSPE-PEG-CPLGLAGSRDIYSTDYYR(PEG-NH2)	DSPE-PEG-CPLGLAGSRDITDYYR is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CPLGLAGSRDITDYYR.Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,forming a structurally clear and functionally adjustable self-assembly system.	price>
R-C-7199	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH)	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) . Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,Used to achieve targeted delivery or other functions.	price>

...