Home > products > phospholipids
> phospholipid-peg-customization
> dsep-peg2k-caceqnpiywaryadwlfttplllldlallvdadegt
DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT
1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene-glycol-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-C-5778 | 100mg | 1425.00 | + Add to cart |
|
|
Product description
DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.
Appearance | N/A |
---|---|
PEG Molecular weight | 2000 |
purity | >90% |
PDI by GPC | <1.5 |
Storage | -20℃ protected from light and moisture |
Transportation | 4-25℃temperature for up to 3 weeks |
Stability | 1year |
Document
Related Product