Catalog |
name |
Description |
price |
R-M-989 |
α-Neoendorphin,CAS : 69671-17-6 |
A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay. |
price> |
R-M-990 |
β-Neoendorphin,CAS : 77739-21-0 |
A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay. |
price> |
R-M-991 |
Nesfatin-1 (human) trifluoroacetate salt,CAS : 917528-35-9 |
Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research. |
price> |
R-M-992 |
Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 |
Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research. |
price> |
R-M-993 |
Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8 |
Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. |
price> |
R-M-994 |
nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9 |
Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment. |
price> |
R-M-995 |
Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 |
Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 from ruixi. It is a synthetic peptide.It can be used for Obesity Research. |
price> |
R-M-996 |
Nesfatin-1-Like Peptide (mouse) trifluoroacetate salt |
The insulinotropic peptide encoded by nucleobindin 1 upregulated preproinsulin mRNA expression and insulin secretion. |
price> |
R-M-998 |
Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt,CAS : 954420-51-0 |
Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt ,CAS:954420-51-0 from ruixi.It can be used in the study of Parkinson disease. |
price> |
R-M-999 |
Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt,CAS:1872441-24-1 |
Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt,CAS:1872441-24-1 from ruixi.It is a synthetic peptide. |
price> |