| Catalog | name | Description | price |
|---|---|---|---|
| R-M-984 | Myelin Oligodendrocyte Glycoprotein (35-55) amide (rat, mouse) trifluoroacetate salt | Myelin Oligodendrocyte Glycoprotein (35-55) amide (rat, mouse) trifluoroacetate salt,CAS: 2022956-48-3 from ruixi.It can be applied to the research of multiple sclerosis. | price> |
| R-M-988 | 1-Naphthalenylsulfonyl-Ile-Trp-aldehyde | Cell-permeable and reversible inhibitor of cathepsin L, a lysosomal cysteine protease ( IC₅₀ 1.9 nM). 1-Naphthalenylsulfonyl-IW-CHO inhibited the release of Ca²⁺ and hydroxyproline from bone in an in vitro bone culture system. It should be useful for the treatment of osteoporosis. | price> |
| R-M-989 | α-Neoendorphin,CAS : 69671-17-6 | A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay. | price> |
| R-M-990 | β-Neoendorphin,CAS : 77739-21-0 | A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay. | price> |
| R-M-991 | Nesfatin-1 (human) trifluoroacetate salt,CAS : 917528-35-9 | Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research. | price> |
| R-M-992 | Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 | Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research. | price> |
| R-M-993 | Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8 | Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. | price> |
| R-M-994 | nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9 | Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment. | price> |
| R-M-995 | Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 | Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 from ruixi. It is a synthetic peptide.It can be used for Obesity Research. | price> |
| R-M-996 | Nesfatin-1-Like Peptide (mouse) trifluoroacetate salt | The insulinotropic peptide encoded by nucleobindin 1 upregulated preproinsulin mRNA expression and insulin secretion. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


