Product peptide-synthetic-peptide

Home > products > peptide> synthetic-peptide

Catalog	name	Description	price
R-M-983	Myelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate salt	MOG peptide (35-55) is highly encephalitogenic and can induce strong T and B cell responses. A single injection of this peptide produces a relapsing-remitting neurologic disease with extensive plaque-like demyelination. Because of the clinical, histopathologic, and immunologic similarities with multiple sclerosis (MS), this MOG-induced demyelinating encephalomyelitis may serve as a model for investigating MS.	price>
R-M-984	Myelin Oligodendrocyte Glycoprotein (35-55) amide (rat, mouse) trifluoroacetate salt	Myelin Oligodendrocyte Glycoprotein (35-55) amide (rat, mouse) trifluoroacetate salt,CAS: 2022956-48-3 from ruixi.It can be applied to the research of multiple sclerosis.	price>
R-M-988	1-Naphthalenylsulfonyl-Ile-Trp-aldehyde	Cell-permeable and reversible inhibitor of cathepsin L, a lysosomal cysteine protease ( IC₅₀ 1.9 nM). 1-Naphthalenylsulfonyl-IW-CHO inhibited the release of Ca²⁺ and hydroxyproline from bone in an in vitro bone culture system. It should be useful for the treatment of osteoporosis.	price>
R-M-989	α-Neoendorphin,CAS : 69671-17-6	A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay.	price>
R-M-990	β-Neoendorphin,CAS : 77739-21-0	A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay.	price>
R-M-991	Nesfatin-1 (human) trifluoroacetate salt，CAS : 917528-35-9	Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research.	price>
R-M-992	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research.	price>
R-M-993	Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8	Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.	price>
R-M-994	nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9	Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.	price>
R-M-995	Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1	Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 from ruixi. It is a synthetic peptide.It can be used for Obesity Research.	price>

...