Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8
H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH trifluoroacetate salt
Product description
Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1872441-21-8 |
Sequence | YDEYLKQVIDVLETDKHFREKLQKADIEEI |
Molecular Formula | C₁₆₇H₂₆₃N₄₁O₅₄ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product