Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1

Nesfatin-1 (rat) trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-995	50ug	360.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	917528-37-1
Sequence	VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
Synonyms	Nucleobindin-2 (1-82) (rat), NUCB2 (1-82) (rat), DNA-Binding Protein NEFA (1-82) (rat)
Molecular Formula	C₄₂₄H₆₈₄N₁₁₆O₁₃₆
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document