Catalog name Description price
R-C-7352 DSPE-PEG-L-Seriner DSPE-PEG2K-L-serine is a typical lipid PEG amino acid functionalized molecule. This molecule is composed of hydrophobic lipid DSPE,flexible polyethylene glycol chain (PEG2K),and terminal amino acid L-serine(Ser),combining lipid embedding ability,PEG flexible water-soluble protection,and amino acid terminal functional properties. DSPE-PEG2K-L-serine is commonly used for surface modification of nanoparticles, self-assembly system construction,and interface functionalization research. price>
R-C-7353 DSPE-PEG-Glutamic acid DSPE-PEG2k-Glutamic acid,Glutamic acid-PEG-DSPE,DSPE-PEG-Glutamic acid is obtained by grafting glutamic acid onto the end of DSPE-PEG.This complex has good hydrophilicity and biocompatibility, and glutamic acid,as an amino acid,is commonly used as a pH sensitive drug carrier in living organisms. price>
R-C-7354 DSPE-SS-PEG-Serine DSPE-SS-PEG2k-Serine,The hydrophobic double chain of DSPE can be embedded into the core of liposomes or nanoparticles,while PEG provides a hydrophilic shell,allowing the entire molecule to spontaneously form stable micelle or liposome structures in the aqueous phase.The disulfide bond(SS)in the middle can be broken in the reducing environment of high concentration glutathione(GSH)in cells,achieving targeted drug release in tumor cells,improving treatment efficiency and reducing systemic toxicity. Serine contains -OH and -NH2 functional groups at the end,which exhibit excellent chemical reactivity and can be used for further coupling of targeted molecules. price>
R-C-7357 DSPE-PEG-D-Ser D-Ser-PEG-DSPE,DSPE-PEG-D-Ser is a composite molecule composed of phospholipids,polyethylene glycol(PEG),and D-serine,belonging to the functional materials in the field of biochemistry. Its core structure combines the hydrophobicity of phospholipids with the hydrophilicity of PEG through chemical modification,and introduces biologically active D-serine to form a molecular complex that combines stability and functionality. price>
R-C-5778 DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. price>
R-C-5789 DSPE-PEG2000-KKKKKKKKKK DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions. price>
R-C-7373 DSPE-PEG-Brown algae polysaccharide DSPE-PEG-Brown Algae Polysaccharide is an amphiphilic functionalized conjugate that covalently links natural active polysaccharides with synthetic high molecular weight phospholipids.It combines the self-assembly ability of lipids,the stability of PEG,and the biological activity of brown algae polysaccharides,demonstrating unique potential in the fields of intelligent drug delivery and targeted therapy.This product is only for scientific research and cannot be used on the human body. price>
R-C-5795 mPEG2K-SS-PEI1.8K-DPSE DPSE-PEI-SS-MPEG,MPEG-SS-PEI-DPSE is a commonly used construct for gene vectors and drug loaded nanoparticles in the biomedical field.In this compound,the mPEG and SS functional groups provide biocompatibility and stability.The presence of PEI can cause it to condense with negatively charged biological molecules such as DNA,making it a gene carrier. price>
R-C-7375 DSPE-PEG-CSKSSDYQC CSKSSDYQC-PEG-DSPE,DSPE-PEG-CSKSSDYQC is a functional molecule that covalently links the goblet cell targeting peptide CSKSSDYQC with phospholipid polyethylene glycol(DSPE-PEG).The molecule is embedded into a liposome or nanoparticle membrane structure through the hydrophobic tail of DSPE,and PEG acts as a hydrophilic spacer arm to enhance colloid stability and prolong circulation time.The exposed CSKSSDYQC peptide segment is responsible for recognizing and binding to M cells or goblet cell surface receptors in Peyers patches of the intestine.This product is only for scientific research and cannot be used on the human body. price>
R-C-5797 DSPE-PEG2000-OCH3 DSPE-PEG-OCH3,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems such as liposomes and lipid nanoparticles.PEGylation can improve the stability and circulation time of the nanoparticles by reducing interactions with proteins and immune recognition.This can lead to improved drug delivery efficiency and reduced clearance rates.The methoxy group (-OCH3) at the end of the PEG chain in DSPE-PEG-OCH3 is often used as a spacer between the nanoparticle surface and any targeting ligands or functional moieties that may be attached. The methoxy group can provide flexibility and prevent steric hindrance, allowing for effective conjugation of targeting ligands or other molecules. price>