Product phospholipids -phospholipid-peg-customization

Home > products > phospholipids > phospholipid-peg-customization

Catalog	name	Description	price
R-C-5770	(ASPSerser6)DSPE-PEG2000-COOH	DSPE-PEG(2000) Carboxylic Acid,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-PEG-succinic acid (DSPE-PEG-COOH), (or N-succinyl-L-α-phosphatidylethanolamine, Distearoyl) is a DSPE-PEG conjugate with carboxylic acid group at the end of PEG. DSPE-PEG-COOH is used to prepare long-circulating liposomes with free COOH on the surface for further modification of peptides and other functional groups (ASPSserser6). This product is only suitable for scientific research and does not require clinical or human experimentation.	price>
R-C-7250	DSPE-PEG-TK-β-CD	DSPE-PEG-TK is an amphiphilic phospholipid polymer with oxidative response properties, widely used in targeted drug delivery systems.It is mainly composed of phospholipid structure,polyethylene glycol chain,and ketothiol responsive bonds,which can achieve intelligent drug release in the tumor microenvironment.Β-CD(β-cyclodextrin)is a cyclic oligosaccharide composed of 7 glucose units connected by α-1,4-glycosidic bonds, forming a hydrophobic cavity that can encapsulate hydrophobic drugs or guest molecules.	price>
R-C-5771	DSPE-PEG2000-CLP003	DSPE-PEG-CLP003,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.This product is only suitable for scientific research and does not require clinical or human experimentation.	price>
R-C-7351	DSPE-PEG-KGCCSDPRCAWR	KGCCSDPRCAWR-PEG-DSPE,DSPE-PEG-KGCCSDRCAWR is a functionalized phospholipid polyethylene glycol conjugate,with a specific peptide sequence KGCCSDPRCAWR attached to its end.It is mainly used to construct targeted nanomedicine delivery systems.KGCCSDPRCAWR peptide is a cyclic twelve peptide with targeted function(formed by side chain modification to form a disulfide bond loop),which can specifically recognize and bind to the highly expressed α v β 3 integrin receptor on the surface of tumor neovascular endothelial cells,mediate receptor-mediated endocytosis, and achieve active targeted enrichment at the tumor site.	price>
R-C-5772	DSPE-PEG2000-CLP003-FITC	DSPE-PEG-CLP003-FITC,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.FITC is a commonly used fluorescent dye that emits green fluorescence when excited by a specific wavelength of light. By attaching FITC to the DSPE-PEG2000-CLP003 conjugate, it allows for visualization and tracking of the conjugate in biological systems.This product is only suitable for scientific research and does not require clinical or human experimentation.	price>
R-C-7352	DSPE-PEG-L-Seriner	DSPE-PEG2K-L-serine is a typical lipid PEG amino acid functionalized molecule. This molecule is composed of hydrophobic lipid DSPE,flexible polyethylene glycol chain (PEG2K),and terminal amino acid L-serine(Ser),combining lipid embedding ability,PEG flexible water-soluble protection,and amino acid terminal functional properties. DSPE-PEG2K-L-serine is commonly used for surface modification of nanoparticles, self-assembly system construction,and interface functionalization research.	price>
R-C-7353	DSPE-PEG-Glutamic acid	DSPE-PEG2k-Glutamic acid,Glutamic acid-PEG-DSPE,DSPE-PEG-Glutamic acid is obtained by grafting glutamic acid onto the end of DSPE-PEG.This complex has good hydrophilicity and biocompatibility, and glutamic acid,as an amino acid,is commonly used as a pH sensitive drug carrier in living organisms.	price>
R-C-7354	DSPE-SS-PEG-Serine	DSPE-SS-PEG2k-Serine,The hydrophobic double chain of DSPE can be embedded into the core of liposomes or nanoparticles,while PEG provides a hydrophilic shell,allowing the entire molecule to spontaneously form stable micelle or liposome structures in the aqueous phase.The disulfide bond(SS)in the middle can be broken in the reducing environment of high concentration glutathione(GSH)in cells,achieving targeted drug release in tumor cells,improving treatment efficiency and reducing systemic toxicity. Serine contains -OH and -NH2 functional groups at the end,which exhibit excellent chemical reactivity and can be used for further coupling of targeted molecules.	price>
R-C-7357	DSPE-PEG-D-Ser	D-Ser-PEG-DSPE,DSPE-PEG-D-Ser is a composite molecule composed of phospholipids,polyethylene glycol(PEG),and D-serine,belonging to the functional materials in the field of biochemistry. Its core structure combines the hydrophobicity of phospholipids with the hydrophilicity of PEG through chemical modification,and introduces biologically active D-serine to form a molecular complex that combines stability and functionality.	price>
R-C-5778	DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT	DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.	price>

...