Product phospholipids -phospholipid-peg-customization

Home > products > phospholipids > phospholipid-peg-customization

Catalog	name	Description	price
R-C-5765	DSPE-PEG-5HT	DSPE-PEG-5-hydroxytryptamine,The DSPE-PEG-5-hydroxytryptamine nanoparticle formulation can be utilized in various biomedical applications. For example, it could be used for targeted drug delivery, where the nanoparticles encapsulate therapeutic agents and specifically deliver them to cells expressing serotonin receptors. Additionally, the formulation could also be used for diagnostic purposes by incorporating imaging agents, allowing for targeted imaging of specific tissues or cells.	price>
R-C-7249	DSPE-PEG-HA-fitc	This product uses DSPE as the hydrophobic anchoring end, and its two octadecyl chains can be stably embedded into the lipid bilayer structure of liposomes or cell membranes; The middle segment is a hydrophilic PEG chain,with HA serving as the biological recognition end,coupled with the amino group at the PEG end through carboxyl groups. Its polysaccharide structure can specifically bind to cell surface receptors(such as CD44), while FITC serves as a fluorescent tracer group,fixed to the HA or PEG end through covalent bonds,providing a green fluorescence signal(excitation wavelength of about 488 nm,emission wavelength of about 520 nm).	price>
R-C-5770	(ASPSerser6)DSPE-PEG2000-COOH	DSPE-PEG(2000) Carboxylic Acid,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-PEG-succinic acid (DSPE-PEG-COOH), (or N-succinyl-L-α-phosphatidylethanolamine, Distearoyl) is a DSPE-PEG conjugate with carboxylic acid group at the end of PEG. DSPE-PEG-COOH is used to prepare long-circulating liposomes with free COOH on the surface for further modification of peptides and other functional groups (ASPSserser6). This product is only suitable for scientific research and does not require clinical or human experimentation.	price>
R-C-7250	DSPE-PEG-TK-β-CD	DSPE-PEG-TK is an amphiphilic phospholipid polymer with oxidative response properties, widely used in targeted drug delivery systems.It is mainly composed of phospholipid structure,polyethylene glycol chain,and ketothiol responsive bonds,which can achieve intelligent drug release in the tumor microenvironment.Β-CD(β-cyclodextrin)is a cyclic oligosaccharide composed of 7 glucose units connected by α-1,4-glycosidic bonds, forming a hydrophobic cavity that can encapsulate hydrophobic drugs or guest molecules.	price>
R-C-5771	DSPE-PEG2000-CLP003	DSPE-PEG-CLP003,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.This product is only suitable for scientific research and does not require clinical or human experimentation.	price>
R-C-5772	DSPE-PEG2000-CLP003-FITC	DSPE-PEG-CLP003-FITC,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.FITC is a commonly used fluorescent dye that emits green fluorescence when excited by a specific wavelength of light. By attaching FITC to the DSPE-PEG2000-CLP003 conjugate, it allows for visualization and tracking of the conjugate in biological systems.This product is only suitable for scientific research and does not require clinical or human experimentation.	price>
R-C-5778	DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT	DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.	price>
R-C-5789	DSPE-PEG2000-KKKKKKKKKK	DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions.	price>
R-C-5795	mPEG2K-SS-PEI1.8K-DPSE	DPSE-PEI-SS-MPEG,MPEG-SS-PEI-DPSE is a commonly used construct for gene vectors and drug loaded nanoparticles in the biomedical field.In this compound,the mPEG and SS functional groups provide biocompatibility and stability.The presence of PEI can cause it to condense with negatively charged biological molecules such as DNA,making it a gene carrier.	price>
R-C-5797	DSPE-PEG2000-OCH3	DSPE-PEG-OCH3,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems such as liposomes and lipid nanoparticles.PEGylation can improve the stability and circulation time of the nanoparticles by reducing interactions with proteins and immune recognition.This can lead to improved drug delivery efficiency and reduced clearance rates.The methoxy group (-OCH3) at the end of the PEG chain in DSPE-PEG-OCH3 is often used as a spacer between the nanoparticle surface and any targeting ligands or functional moieties that may be attached. The methoxy group can provide flexibility and prevent steric hindrance, allowing for effective conjugation of targeting ligands or other molecules.	price>

...