Catalog name Description price
R-M-1745 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. price>
R-M-1749 Fmoc-Thr[GalNAc(Ac)3-α-D]-OH, CAS:116783-35-8 price>
R-M-1774 Angstrom6,cas:220334-14-5  Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling. price>
R-M-1779 α-Factor Mating Pheromone, yeast,cas:59401-28-4  α-Factor Mating Pheromone, yeast is a tridecapeptide secreted by S. cerevisiae α cells via Ste2p receptor. price>
R-M-1780 SEB Domain (144-153) (TFA)  SEB Domain 144-153 TFA is Staphylococcal Enterotoxin B domain amino acid residue 144-153. Staphylococcal enterotoxin B (SEB) is a toxin produced by Staphylococcus aureus. price>
R-M-1783 Chemerin-9 (149-157) (TFA)  Chemerin-9 (149-157) TFA, the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR.Chemerin-9 (149-157) TFA, the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR. price>
R-M-1787 Fz7-21 TFA Fz7-21 (Ac-LPSDDLEFWCHVMY-NH2) TFA,a peptide antagonist of Frizzled 7 (FZD 7) receptors, selectively binds to FZD7 CRD subclass. The EC50 values are 58 and 34 nM for human and mouse FZD7 CRD, respectively. Fz7-21 impairs Wnt/β-catenin signaling in HEK293 cells stimulated with exogenous WNT3A (IC50=100 nM) or transfected with a construct expressing WNT3A or WNT1. Fz7-21 also blocks WNT3A-mediated stabilization of β-catenin in mouse L cells (IC50=50 nM). price>
R-M-1788 Oglufanide,cas:38101-59-6  Oglufanide (H-Glu-Trp-OH) is a dipeptide immunomodulator isolated from calf thymus. Oglufanide inhibits vascular endothelial growth factor (VEGF). Oglufanide can stimulate the immune response to hepatitic C virus (HCV) and intracellular bacterial infections. price>
R-M-1796 LCMV gp33-41 TFA  LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes. price>
R-M-1800 VSV-G tag Peptide  VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein. price>