| Catalog | name | Description | price |
|---|---|---|---|
| R-M-1745 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | price> |
| R-M-1749 | Fmoc-Thr[GalNAc(Ac)3-α-D]-OH, CAS:116783-35-8 | price> | |
| R-M-1774 | Angstrom6,cas:220334-14-5 | Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling. | price> |
| R-M-1779 | α-Factor Mating Pheromone, yeast,cas:59401-28-4 | α-Factor Mating Pheromone, yeast is a tridecapeptide secreted by S. cerevisiae α cells via Ste2p receptor. | price> |
| R-M-1780 | SEB Domain (144-153) (TFA) | SEB Domain 144-153 TFA is Staphylococcal Enterotoxin B domain amino acid residue 144-153. Staphylococcal enterotoxin B (SEB) is a toxin produced by Staphylococcus aureus. | price> |
| R-M-1783 | Chemerin-9 (149-157) (TFA) | Chemerin-9 (149-157) TFA, the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR.Chemerin-9 (149-157) TFA, the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR. | price> |
| R-M-1787 | Fz7-21 TFA | Fz7-21 (Ac-LPSDDLEFWCHVMY-NH2) TFA,a peptide antagonist of Frizzled 7 (FZD 7) receptors, selectively binds to FZD7 CRD subclass. The EC50 values are 58 and 34 nM for human and mouse FZD7 CRD, respectively. Fz7-21 impairs Wnt/β-catenin signaling in HEK293 cells stimulated with exogenous WNT3A (IC50=100 nM) or transfected with a construct expressing WNT3A or WNT1. Fz7-21 also blocks WNT3A-mediated stabilization of β-catenin in mouse L cells (IC50=50 nM). | price> |
| R-M-1788 | Oglufanide,cas:38101-59-6 | Oglufanide (H-Glu-Trp-OH) is a dipeptide immunomodulator isolated from calf thymus. Oglufanide inhibits vascular endothelial growth factor (VEGF). Oglufanide can stimulate the immune response to hepatitic C virus (HCV) and intracellular bacterial infections. | price> |
| R-M-1796 | LCMV gp33-41 TFA | LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes. | price> |
| R-M-1800 | VSV-G tag Peptide | VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


