Catalog |
name |
Description |
price |
R-M-1672 |
Human IkBa (20-39) |
This peptide is a 20 to 39 amino acid residues fragment of human IkBa,. Following cellular stimulation, specific IkB kinases (IKKs) are activated resulting in phosphorylation of serines 32 and 36 on human IkBa. The subsequent cascade of cellular events leads to the translocation of transcription factor to the nucleous where it initiates specific transcription. |
price> |
R-M-1704 |
Steroid Receptor Co-Factor Peptide |
This peptide is a 14-amino acid fragment from the steroid receptor cofactor SRC-1 NR II. |
price> |
R-M-1707 |
Steroid Receptor Coactivator-1 (SRC-1), (676-700), biotin labeled |
This is amino acids 676 to 700 fragment of steroid receptor co-activator (SRC1). This N-terminnaly biotinylated peptide is derived from the second LXXLL motif of SRC1. Co-activator proteins interact with nuclear receptors in a ligand-dependent manner and augment transcription. A short amphipathic betalpha-Helical domain that includes this LXXLL motif serves as the interaction interface between the co-activator molecules and the ligand-dependent activation function (AF-2) located in the COOH-terminus of the nuclear receptor ligand-binding domain (LBD). Receptor binding domain of the co-activator SRC-1 is specifically recruited to the farnesoid X receptor (FXR) ligand-binding domain. |
price> |
R-M-1719 |
p53 Tumor Suppressor (361-393), LC-Biotin, human |
This peptide is amino acids 361 to 393 fragment of p53 tumor suppressor protein. This sequence is biotinylated through the LC spacer on the N-terminus. p53 is a transcription factor that regulates cell cycle and functions as a tumor supressor. |
price> |
R-M-3097 |
Suc-Leu-Leu-Val-Tyr-AMC,cas:94367-21-2 |
Suc-Leu-Leu-Val-Tyr-AMC (Suc-LLVY) is a membrane-permeable calpain-specific fluorogenic substrate, pteolytic hydrolysis of the peptidyl-7-amino bond liberates the highly fluorescent 7-amino-4-methylcoumarin (AMC) moiety. |
price> |
R-M-1734 |
CEP dipeptide 1,CAS: 816432-15-2 |
CEP dipeptide 1 is a CEP dipeptide derivative with angiogenic activity. |
price> |
R-M-1739 |
HAE,CAS : 64111-99-5 |
HAE is a 3-amino acid peptide which consists of histidine, alanine and glutamate. |
price> |
R-M-1744 |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia. |
price> |
R-M-1745 |
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. |
price> |
R-M-1749 |
Fmoc-Thr[GalNAc(Ac)3-α-D]-OH, CAS:116783-35-8 |
|
price> |