Product peptide-amino-acid-polypeptide

Home > products > peptide> amino-acid-polypeptide

Catalog	name	Description	price
R-M-1645	Glu-Glu epitope Tag	This peptide is a 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus. Glu-Glu epitope peptide is widely used as an epitope tag.	price>
R-M-1672	Human IkBa (20-39)	This peptide is a 20 to 39 amino acid residues fragment of human IkBa,. Following cellular stimulation, specific IkB kinases (IKKs) are activated resulting in phosphorylation of serines 32 and 36 on human IkBa. The subsequent cascade of cellular events leads to the translocation of transcription factor to the nucleous where it initiates specific transcription.	price>
R-M-1704	Steroid Receptor Co-Factor Peptide	This peptide is a 14-amino acid fragment from the steroid receptor cofactor SRC-1 NR II.	price>
R-M-1707	Steroid Receptor Coactivator-1 (SRC-1), (676-700), biotin labeled	This is amino acids 676 to 700 fragment of steroid receptor co-activator (SRC1). This N-terminnaly biotinylated peptide is derived from the second LXXLL motif of SRC1. Co-activator proteins interact with nuclear receptors in a ligand-dependent manner and augment transcription. A short amphipathic betalpha-Helical domain that includes this LXXLL motif serves as the interaction interface between the co-activator molecules and the ligand-dependent activation function (AF-2) located in the COOH-terminus of the nuclear receptor ligand-binding domain (LBD). Receptor binding domain of the co-activator SRC-1 is specifically recruited to the farnesoid X receptor (FXR) ligand-binding domain.	price>
R-M-1719	p53 Tumor Suppressor (361-393), LC-Biotin, human	This peptide is amino acids 361 to 393 fragment of p53 tumor suppressor protein. This sequence is biotinylated through the LC spacer on the N-terminus. p53 is a transcription factor that regulates cell cycle and functions as a tumor supressor.	price>
R-M-3097	Suc-Leu-Leu-Val-Tyr-AMC,cas:94367-21-2	Suc-Leu-Leu-Val-Tyr-AMC (Suc-LLVY) is a membrane-permeable calpain-specific fluorogenic substrate, pteolytic hydrolysis of the peptidyl-7-amino bond liberates the highly fluorescent 7-amino-4-methylcoumarin (AMC) moiety.	price>
R-M-1734	CEP dipeptide 1,CAS: 816432-15-2	CEP dipeptide 1 is a CEP dipeptide derivative with angiogenic activity.	price>
R-M-1739	HAE,CAS : 64111-99-5	HAE is a 3-amino acid peptide which consists of histidine, alanine and glutamate.	price>
R-M-1744	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia.	price>
R-M-1745	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.	price>

...