FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-1744	2mg	650.00	- +	+ Add to cart
R-M-1744	5mg	1120.00	- +	+ Add to cart

Product description

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Sequence	Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
One letter sequence	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document