Catalog name Description price
R-M-5090 Antioxidant peptide A TFA Antioxidant peptide A TFA is a short peptide, which contains alternative aromatic or sulfur-containing amino acid. The side chains of Antioxidant peptide A are believed to contribute to strong radical scavenging activities of peptides in the cancer cell. price>
R-M-5094 MUC5AC motif peptide MUC5AC motif peptide is a 16-amino acid fragment of mucin 5.The MUC5AC mucin motif peptide (GTTPSPVPTTSTTSAP) is a single-letter amino acid codes. The peptide GTTPSPVPTTSTTSAP, mimicking the human mucin tandem repeat of MUC5AC, has been thought to be of value because of the existence of four identical repeats within the sequence of the clone JER58 (GTTPSAVPTTSTTSVPand GTTPSPVPTTSITSVP). price>
R-M-5096 Erythropoietin Mimetic Peptide Sequence 20,cas:203397-62-0 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist. price>
R-M-5098 CBP501 Affinity Peptide CBP501 Affinity Peptide,CAS :1351804-17-5 from ruixi.This 14-mer peptide shows similarity to a portion of the alphaC helix of human 14-3-3e. price>
R-M-5101 N-acetyl-Pro-Gly-Pro Peptide N-acetyl-Pro-Gly-Pro (N-acetyl-PGP) is a tripeptide that functions as a neutrophil chemoattractant.These data suggest that N-acetyl-PGP or PGP may be useful biomarkers and potential therapeutic targets for neutrophilic inflammatory diseases. price>
R-M-5105 Bim BH3, Peptide IV,cas:2088247-34-9 Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins. price>
R-M-5106 ATWLPPR Peptide TFA  ATWLPPR Peptide TFA, a heptapeptide, acts as a selective neuropilin-1 inhibitor, inhibits VEGF165 binding to NRP-1, used in the research of angiogenesis. ATWLPPR Peptide TFA has potential in reducing the early retinal damage caused by diabetes. price>
R-M-5107 NGR peptide NGR peptide Trifluoroacetate containing the asparagine-glycine-arginine (NGR) motif is recognized by CD13/aminopeptidase N (APN) receptor isoforms that are selectively overexpressed in tumor neovasculature.NGR peptide imaging in vivo not only provides more insight into NGR’s targeting process, including bio-distribution and pharmacokinetics, but also reveals angiogenic activities related to tumor progression and malignancy. price>
R-M-5164 WYRGRLC WYRGRLCis a short collagen binding peptide, which can be used for cartilage targeted drug delivery. It combines with nanoparticles to form a drug delivery platform. price>
R-M1-8752 TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECATSLNPDYREEDTDVR is a peptide sequence that can be used for drug delivery and targeted research. price>