| Catalog | name | Description | price |
|---|---|---|---|
| R-M1-8452 | Methyltetrazine-DBCO | Methyltetrazine-DBCO compound is particularly useful in bioconjugation, labeling, and imaging applications. It enables the selective and bioorthogonal labeling of biomolecules or surfaces, allowing for the visualization and tracking of specific targets or structures. This compound is often used in combination with other imaging agents or labels to facilitate the detection and study of biological processes in cells or living organisms. | price> |
| R-M2-10089 | Ferrocene-DBCO | Ferrocene-DBCO has copper free click chemistry activity, electrochemical and biocompatibility.It is suitable for biomolecule labeling, drug delivery system construction, and biomaterial functionalization. | price> |
| R-M2-10091 | Ferrocene-Azide | Ferrocene Azide is an organic metal compound that combines ferrocene and azide groups The ferrocene moiety provides stable electron transfer ability, and the azide group can efficiently couple biomolecules or nanomaterials through click chemistry (such as reacting with alkynyl groups). Functional application: Electrochemical labeling: used for labeling antibodies, nucleic acids, etc., achieving high-sensitivity detection through the redox signal of ferrocene. Drug delivery: As a responsive carrier, it triggers drug release in the tumor microenvironment. Biosensors: Modify electrodes to detect small molecules such as H2O2 and lactic acid. Synthesis and stability: Solid phase peptide synthesis or click chemical connection is required, and it should be dried and stored in the dark to maintain activity. | price> |
| R-M2-10120 | DBCO-CpG | DBCO-CpG is a complex that combines dibenzocyclooctyne (DBCO) and CpG, mainly used in biological coupling and immunotherapy research.CpG sequence (phosphorothioate backbone):TCGAACGTTCGAACGTTCGAACGTTCGAAT. | price> |
| R-M2-10122 | DBCO-E7 | DBCO-E7 peptide (GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) is an E7 derived peptide modified with DBCO (dibenzocyclooctyne), mainly used for biological coupling and targeting research. Application Scenario: Drug delivery: Can be coupled with drugs or nanoparticles for targeted therapy of HPV related tumors. Imaging and Diagnosis: Used to label fluorescent or radioactive probes to assist in disease diagnosis. Mechanism research: Help to elucidate the role of E7 protein in tumorigenesis. | price> |
| R-M1-8523 | DBCO-Hemin-DBCO | DBCO-Hemin-DBCO is a compound that includes two DBCO reactive groups and a Hemin molecule. This compound enables the conjugation of Hemin to other molecules or surfaces through the use of click chemistry. The DBCO groups provide a simple and efficient way to attach Hemin to azide-containing molecules for various applications in biology and biomedicine. | price> |
| R-M1-8527 | DBCO-C6-Br | DBCO-C6-Br can be used as a building block or intermediate in bioconjugation strategies, where the DBCO moiety selectively reacts with azide-containing molecules or surfaces via SPAAC reaction. | price> |
| R-M1-8528 | DBCO-ß-Cyclodextrin | DBCO-ß-Cyclodextrin can be utilized in various fields such as pharmaceuticals, chemistry, and biomedical research where efficient solubilization and targeted delivery of hydrophobic compounds are required. | price> |
| R-M1-8551 | DBCO-RGD | DBCO-RGD is often utilized in the development of targeted therapeutics, imaging agents, or surface modifications for specific cell adhesion and signaling applications. | price> |
| R-M1-8561 | DBCO dopamine | By conjugating dopamine with DBCO, researchers can introduce specific functional groups to dopamine and utilize its neurochemical properties for various purposes. For example, DBCO dopamine can be used to attach dopamine to biomolecules, nanoparticles, or surfaces for targeted drug delivery or imaging applications. This conjugate offers a versatile tool for studying dopamine signaling and its interactions in biological systems. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


