DBCO-E7

DBCO-E7 peptide (GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) is an E7 derived peptide modified with DBCO (dibenzocyclooctyne), mainly used for biological coupling and targeting research.

Application Scenario:

Drug delivery: Can be coupled with drugs or nanoparticles for targeted therapy of HPV related tumors.

Imaging and Diagnosis: Used to label fluorescent or radioactive probes to assist in disease diagnosis.

Mechanism research: Help to elucidate the role of E7 protein in tumorigenesis.

msds of DBCO-E7