Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M-5411	5(6)-Rhodamine 6G maleimide	5(6)-Rhodamine 6G maleimide from ruixi. Rhodamine 6G is one of the rhodamine family dyes with high fluorescence properties, showing yellow green fluorescence. In life science research, it is often used as tracking dye in detection methods such as fluorescence microscope, flow cytometer and enzyme labeling instrument. Rhodamine 6G has good water solubility and fluorescence spectrum between FITC and Cy3. It is economical and has a wide range of applications Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling.	price>
R-C-4746	DSPE-polyethylene glycol550-GSH	DSPE phospholipids have the functions of emulsification and drug solubilization as pharmaceutical excipients, and are important materials for slow-release and controlled-release drug preparations such as liposomes, fat emulsions and nanoparticles in recent years. The modification of phospholipid molecules can make these preparations have the ability to release and target under specific conditions. GSH is a blood-brain barrier shuttle peptide that can transport NPs to the blood-brain barrier through GSH transport protein.	price>
R-M1-8864	mPEG2000-CPP30	mPEG2000-CPP30/mPEG2000-CPP30(RLYMRYYSPTTRRYG)/mPEG2k-CPP30/mPEG2k-RLYMRYYSPTTRRYG may find application in drug delivery systems, molecular imaging, and other biotechnological and biomedical research fields where improving cellular uptake and targeting is necessary.	price>
R-M-5412	5(6)-RBITC	5(6)-RBITC is an isocyanate of Rhodamine B, which can be used to label amino functional groups. Compared with NHS activated ester, isocyanate is more stable, but the reaction activity is lower than NHS activated ester.	price>
R-C-4747	DSPE-PEG750-Glutathione	DSPE phospholipids have the functions of emulsification and drug solubilization as pharmaceutical excipients, and are important materials for slow-release and controlled-release drug preparations such as liposomes, fat emulsions and nanoparticles in recent years. The modification of phospholipid molecules can make these preparations have the ability to release and target under specific conditions. GSH is a blood-brain barrier shuttle peptide that can transport NPs to the blood-brain barrier through GSH transport protein.	price>
R-M1-cs8865	Ni@Au Core-shell nanoparticles	Ni@Au core-shell nanoparticles/ Ni-Au core-shell nanoparticles are nanostructures consisting of a nickel (Ni) core surrounded by a shell of gold (Au). These hybrid nanoparticles combine the properties of both nickel and gold, offering a unique combination of attributes that make them valuable in various applications.The nickel core provides magnetic properties, allowing the nanoparticles to be manipulated using external magnetic fields. This magnetic behavior can be harnessed for applications such as magnetic separation, targeted drug delivery, and magnetic resonance imaging (MRI) contrast agents.The gold shell offers several advantageous features, including its biocompatibility, stability, and ease of functionalization with a variety of molecules. As a result, Au-coated nanoparticles are frequently used in biomedical applications, such as targeted drug delivery, photothermal therapy, and bioimaging.	price>
R-M-5413	5(6)-TAMRA-maleimide	5(6)-TAMRA-maleimide,5(6)-Tetramethylrhodamine-maleimide from ruixi.Tetramethylrhodamine,namely tetramethylrhodamine (TMR, Tamra), is a fluorescent dye commonly used in biological coupling. It is often used to connect antibodies, avidin and so on for immunochemistry. TMR and Tamra are the common names of this dye in the literature. Tamra generally introduces carboxylic acid at position 5 or 6 for labeling. Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling. Although amino groups (such as lysine arginine side chain) also have affinity, maleimide selectively labels sulfhydryl groups in neutral or slightly acidic buffer (reaction speed > 1000 times faster than amino groups). The labeling reaction has the advantages of rapid reaction, high selectivity and good yield. In addition, sulfhydryl is a functional group widely existing in biomolecules, such as serine and disulfide bond in proteins. Therefore, maleimide / thiol labeling has become the most commonly used biological ligation reaction second only to NHS / amino labeling.	price>
R-C-4748	PLL-Cholic acid	PLL-CA，Cholic acid is the main component of bile acid. It is insoluble in water, soluble in ethanol and acetic acid. Its solid state is white crystal, and its salts are called bile salts. The derivatives of cholic acid are mainly produced by cholic acid - coenzyme A, in which CoA can exchange with glycine or taurine to produce glycine cholic acid or taurocholic acid.	price>
R-M1-8866	5-TTTTTTTT-TTAGGGCATGCACTAC-FITC-3	This type of DNA sequence is commonly used for molecular biology and genetic research purposes, such as in fluorescence in situ hybridization (FISH) or other fluorescent labeling assays. In this case, the FITC molecule allows for the visualization and detection of the DNA sequence within a biological sample or experimental assay, as FITC emits green fluorescence when excited by appropriate light.The DNA sequence itself, "GGGCATGCACTAC," could potentially serve as a probe for targeting complementary sequences or specific genetic regions in research applications, while the presence of the FITC label enables visualization and tracking of the labeled DNA sequence within a biological context.	price>
R-M-5414	5(6)-TRITC	5(6)-TRITC,Tetramethylrhodamine isothiocyanate, 5 and 6 isomers from ruixi.5(6)-TRITC is an isocyanate of tetramethylrhodamine (Tamra), which can be used to label amino functional groups. Compared with NHS activated ester, isocyanate is more stable, but the reaction activity is lower than NHS activated ester.	price>
R-M1-8867	CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR	This sequence(CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR) represents a linear chain of amino acids that would fold and interact with other molecules to form the functional three-dimensional structure of a protein or peptide. The specific function or properties of the protein or peptide corresponding to this sequence would depend on its overall structure, interactions with other molecules, and cellular context.	price>
R-M-5415	ROX NHS ester, 5 and 6 isomers	ROX NHS ester, 5 and 6 isomers,Rhodamine X NHS ester , 5 and 6 isomers from ruixi.Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. In the field of fluorescent dyes, Rox often refers to Rox derivatives with 5 / 6 carboxylic acid structure, which can be used for the activation and labeling of fluorescent dyes. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need membrane penetration NHS activated ester (N-hydroxysuccinimide ester, successful ester, Se) is the most commonly used activated group in biomarker reaction. NHS activates the carboxyl group in the dye molecule, so that it can react with the amine group (main primary amine) on the target biological molecule to form a stable amide bond, so as to label the dye molecule on the biological macromolecule.	price>
R-M1-8868	NH2-PEG1000-HKNKGKKNGKHNGWK	NH2-PEG1000-HKNKGKKNGKHNGWK could be utilized for various purposes such as drug delivery, biotechnology applications, or as a targeting ligand. The presence of the PEG linker can help enhance the solubility and stability of the peptide and potentially modulate its pharmacokinetic properties.	price>
R-M-5416	Rhodamine X carboxylic acid	Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. In the field of fluorescent dyes, Rox often refers to Rox derivatives with 5 / 6 carboxylic acid structure, which can be used for the activation and labeling of fluorescent dyes. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need to penetrate the membrane. The product is Rox carboxylic acid, and the functional groups are not activated. Therefore, the labeled dye will not react with any functional groups and is very stable in organic solvents or aqueous solvents.	price>
R-M1-ct8869	EBNAl562-570:FMVFLQTHI	The notation "EBNA1 562-570:FMVFLQTHI" represents a specific sequence derived from the Epstein-Barr virus nuclear antigen 1 (EBNA1). The sequence "FMVFLQTHI" corresponds to amino acids 562 to 570 of the EBNA1 protein.Epstein-Barr virus (EBV) is a member of the herpesvirus family and is known to cause infectious mononucleosis (glandular fever). The EBNA1 protein is expressed during latent infection and is involved in maintaining the viral genome in latently infected cells.	price>
R-M-5417	ROX amine	Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need membrane penetration (Rox amine) the product contains amino functional groups and can react with functional groups such as carboxylic acid. 6 carbon short chain helps to separate dye molecules from labeled objects, improve labeling efficiency and reduce the impact of labeled objects on dye molecules.	price>
R-M1-8870	LMP2A426-434:CLGGLLTMV	The notation "LMP2A426-434:CLGGLLTMV" represents a specific sequence derived from the Epstein-Barr virus (EBV) latent membrane protein 2A (LMP2A). The sequence "CLGGLLTMV" corresponds to amino acids 426 to 434 of the LMP2A protein.LMP2A is a protein encoded by EBV that has been implicated in viral latency and immune evasion. Sequence notations like "LMP2A426-434:CLGGLLTMV" are commonly used in the context of immunological research and vaccine development. This sequence may serve as an epitope or antigenic determinant for immune responses and could be a target for studying the interactions of the EBV virus with the immune system.	price>
R-M-5418	X-Rhodamine maleimide	Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need membrane penetration (x-rhodamine maleimide) the active group of the product is maleimide. Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling.	price>
R-C-4753	DSPE-PEG-cRGD-FITC	Pegylated phospholipids are excellent liposome formation materials that can be used for drug delivery, gene transfection and vaccine delivery as well. Pegylation of phospholipids significantly improves the blood circulation time and stability for encapsulated drugs. Fluorescein labeled DSPE PEG products emitted green fluorescence and can be easily detected withÂ fluorescent microscopy or spectroscopy.cRGD is an active target material,It can be used as an antitumor drug carrier and active targeted delivery.	price>
R-M1-cs8871	Human serum albumin nanoparticles@lidocaine	Human serum albumin is a commonly used carrier molecule for drug delivery due to its biocompatibility and ability to encapsulate or bind with various drugs. When combined with lidocaine, it forms nanoparticles wherein the drug is likely encapsulated or conjugated to the surface of the HSA nanoparticles. The use of HSA nanoparticles as a carrier for lidocaine can have several potential benefits for drug delivery, including improved solubility, controlled release, targeted delivery, and reduced toxicity. These nanoparticles can enhance the pharmacokinetic profile and tissue distribution of lidocaine, potentially improving the effectiveness of the drug for various therapeutic applications.	price>

904905906907908909 910911912913914