CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR
CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M1-8867 | 50mg | 469.00 | + Add to cart |
|
R-M1-8867 | 100mg | 735.00 | + Add to cart |
|
|
Product description
This sequence(CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR) represents a linear chain of amino acids that would fold and interact with other molecules to form the functional three-dimensional structure of a protein or peptide. The specific function or properties of the protein or peptide corresponding to this sequence would depend on its overall structure, interactions with other molecules, and cellular context.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Sequence | CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product