Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-C-5778	DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT	DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.	price>
R-M1-8162	Octadecyl-peg2k-sulphate	Octadecyl-peg2k-sulphate,Octadecyl polyethylene glycol sulphate/sulfate(ion) It is a bifunctional peg reagent.	price>
R-C-5779	Mesoporous silica encapsulated drug (Requinmod) 50NM	Mesoporous silica is a highly structured and ordered nanomaterial with a large number of pores and a high specific surface area. The encapsulation of Risedronate into 50 nanometer sized mesoporous silica can achieve efficient drug transport and controlled release. Mesoporous silica can also provide a certain protective effect to prevent the decomposition and deactivation of drugs.	price>
R-M1-8163	3,3-Dioctyl-2,25,2-terthiophene,CAS:155166-89-5	3,3-Dioctyl-2,2 5,2-terthiophene (DOT) is a novel organic compound with potential applications in a variety of fields. It is a polycyclic aromatic hydrocarbon (PAH) that has a planar, aromatic structure and a wide range of physical and chemical properties. DOT is a highly versatile compound, and its unique properties make it an attractive candidate for a variety of applications in materials science, pharmaceuticals, and biochemistry.	price>
R-C-5780	Ag2Te QDs (Oil phase) transmit:1500	Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution.transmit:1500	price>
R-M1-8164	Ni-NTA-Nano gold,10 nm	Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting.	price>
R-C-5781	Ag2Te QDs (aqueous phase) transmit:1500	Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution.	price>
R-C-5782	TCPP-Cu(2+) CAS:41699-93-8	Cu(II) meso-Tetra(4-carboxyphenyl)porphine is a synthetic porphyrin.CU(II) Meso-tetra(4-carboxyphenyl)porphine has has been studied for its versatile applications across various fields,including catalysis,electrochemistry, photochemistry, and biochemistry.In catalysis,this compound has exhibited exceptional efficacy as a catalyst,facilitating diverse organic reactions like alcohol oxidation and nitro compound reduction.	price>
R-M1-8165	Ni-NTA-Nanogold,5 nm	5 nm Ni-NTA-Nanogold® provides new features, improved performance, and extends NTA-Ni(II) targeting technology to larger gold size.Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting.	price>
R-M1-8166	1.8nm Ni-NTA-Nanogold	Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting.	price>
R-C-5783	PEI1.8K-Nonadecafluorodecanoic Acid	PEI-Nonadecafluorodecanoic Acid,Polyethyleneimine (PEI) is a cationic polymer with repeating ethyleneimine units.Nonadecafluorodecanoic acid (NFDA) is a perfluorinated carboxylic acid with nineteen fluorine atoms. It is a hydrophobic compound that can interact with hydrophobic surfaces or molecules.When PEI and NFDA are combined, they can form a complex through electrostatic interactions and hydrophobic interactions. The positive charges of PEI can interact with the carboxylate groups of NFDA, while the hydrophobic fluorocarbon chain of NFDA can interact with hydrophobic entities.	price>
R-M1-8167	mPEG5K-FHKHKSPALSPV	mPEG5K-FHKHKSPALSPV is a synthetic peptide compound.	price>
R-C-5784	PLGA5000-b-PEOz2000-NHS	PLGA-b-PEOz-NHS,PLGA-PEOz-NHS,PLGA-PEOz-NHS is an amphiphilic AB diblock copolymer composed of hydrophilic PEOz and hydrophobic poly(D,L-lactide co glycolide).PEOz polymers are capped by active esters and can react with other reactive chemical groups such as amino modified proteins,peptides,and other materials.PEOz can completely replace PEG polyethylene glycol as a drug carrier material and can be used to prepare pH responsive nanoparticles for drug delivery.	price>
R-M1-8168	Dextran-Amine,MW:2000	Dextran-Amine,MW:2000，it can be react with NHS or COOH.	price>
R-C-5785	5-(4-aminophenyl)-10,15,20-triphenyl porphine CAS:67605-64-5	4-(10,15,20-Triphenylporphyrin-5-yl)phenylamine,CAS:67605-64-5 ,5-(4-aminophenyl)-10,15,20-triphenyl porphine is a porphyrin used in proteomics research.This product is only used for scientific research experiments and not for human or clinical experiments.	price>
R-M1-8169	Chlorogenic acid-SH	Chlorogenic acid-SH is a thiolated covalent coupling compound. Chlorogenic acid has a wide range of antibacterial effects, but can be inactivated by proteins in the body. Similar to caffeic acid, oral or intraperitoneal injection can increase central excitability in rats.	price>
R-C-5786	COOH-PEOz MW:2K	PEOz-COOH,poly(2-ethyl-2-oxazoline)-carboxylic acid,The carboxylic acid functional groups(-COOH) in PEOz-COOH can be utilized for various purposes.They can enable the conjugation of molecules or therapeutic agents to the polymer backbone through covalent bonding.This conjugation can be performed to incorporate specific functionalities,improve drug loading,or enhance the stability of the polymer matrix.	price>
R-M1-8170	CY5.5-N- acetylcysteine	CY5.5-N-acetylcysteine is a fluorescent labeled polypeptide compound.Acetylcysteine is mainly used as a mucolytic agent and has a strong mucolytic effect. The sulfhydryl group contained in its molecule can break the disulfide bond in the glycoprotein polypeptide chain in sputum, thereby reducing the viscosity of sputum, making it liquefied and easy to cough up, and also breaking DNA fibers in purulent sputum	price>
R-C-5787	PAMAM Dendrimer G2.5 Caboxylate Sodium Salt	Polyamidoamine(PAMAM)dendrimers are hyperbranched polymers with unparalleled molecular uniformity, narrow molecular weight distribution, defined size and shape characteristics and a multifunctional terminal surface.These nanoscale polymers consist of an ethylenediamine core, a repetitive branching amidoamine internal structure and a primary amine terminal surface.	price>
R-M1-8171	CY5.5-antioxidant enzyme	CY5.5-antioxidant enzyme is a fluorescent dye labeled peroxide that can be used for the study of oxidation reactions. Antioxidant enzymes have the effect of converting peroxides formed in the body into less toxic or harmless substances.	price>

103310341035103610371038 10391040104110421043