Home > Keywords >
Catalog | name | Description | price |
---|---|---|---|
R-M-7004 | BDP FL-PEG5-azide,cas2093197-91-0 | BDP FL-PEG5-azide is a PEG linker with an azide group and BDP FL dye moiety. The azide group enables Click Chemistry and BDP FL dye moiety is highly compatible with FAM fluorescence measuring instruments. The hydrophilic PEG spacer arm increases water solubility and a membrane permability. | price> |
R-C-5520 | Agarose CAS9012-36-6 | Agarose forms a gel matrix when dissolved in water and heated, which then solidifies upon cooling. This gel matrix has a porous structure that allows for the separation of biomolecules based on their size. Agarose gels are commonly used in gel electrophoresis to separate and visualize DNA fragments or RNA molecules. | price> |
R-M2ys-9538 | CTAB-Capped Au Nanospheres | CTAB-capped gold nanospheres/Cetyltrimethylammonium bromide (CTAB)-capped gold nanoparticles are a versatile nanomaterial with promising applications across various fields.CTAB-capped gold nanospheres are used in drug delivery systems, imaging, photothermal therapy, and as contrast agents in various imaging techniques like computed tomography (CT) and magnetic resonance imaging (MRI).They can be employed in biosensors and chemical sensors, leveraging their optical properties for detecting biomolecules or environmental pollutants.Gold nanospheres can serve as catalysts in various chemical reactions due to their high surface area and reactivity.They are used in the development of sensors and electronic devices thanks to their electrical conductivity and tunable properties. | price> |
R-M-7008 | BDP FL-PEG4-amine TFA salt,cas2183473-14-3 | BDP FL-PEG4-amine TFA salt is a BDP FL linker containing an amine group and a hydrophilic PEG spacer arm. The amine group makes the compound more reactive toward carboxylic acids, NHS esters and other carbonyl groups. The hydrophilic PEG spacer arm can increase water solubility. | price> |
R-C-5521 | Cyanogen bromide-activated Agarose CAS68987-32-6 | Cyanogen bromide-activated agarose is a type of agarose resin that has been modified with cyanogen bromide functional groups. Cyanogen bromide is a chemical compound that reacts specifically with primary amino groups (-NH2) in proteins or other biomolecules. | price> |
R-M2-9539 | 111In-DOTA-NCS-ST-peptide | 111In-DOTA-NCS-ST-peptide,111In-DOTA-NCS-6-Ahx-Phe19-ST[1-19] is a promising compound for enhancing the precision of imaging and treatment in oncology. Its design allows for the effective targeting of tumors, and ongoing research explores its full potential in clinical applications. The ability to label peptides with 111In through stable chelation with DOTA and reactive NCS groups provides a fascinating avenue for the development of advanced radiopharmaceuticals, merging nuclear medicine with peptide-targeted therapy. | price> |
R-M-7009 | BD140,cas:1201643-08-4 | BD140 for Albumin binding assay. | price> |
R-C-5522 | C16 PEG Ceramide CAS:212116-78-4 | C16 PEG Ceramide, MW 750 CAS: 212116-78-4 is a ceramide PEGylated lipid complex, its acyl chain length is not the same, it is a heterogeneous lipid molecule, wrapped in polyethylene glycol (PEG) combined therapeutic drug in ceramide as liposome carrier, ensuring longer circulation period. | price> |
R-M2-9540 | SH-PEG1k-RKRLQVQLSIRT | SH-PEG1k-RKRLQVQLSIRT/Thiol-PEG1k-RKRLQVQLSIRT/RKRLQVQLSIRT-PEG1k-Thiol/RKRLQVQLSIRT-PEG1k-SH is a versatile and functional peptide conjugate suitable for various applications in drug delivery, diagnostics, and research. The combination of the thiol group, PEG spacer, and a biologically active peptide sequence enhances the potential for targeted treatments and studies in molecular biology and therapeutic development. | price> |
R-M-7010 | IRDye® 680RD Mal | IRDye 680RD Maleimide will label molecules with free sulfhydryl (-SH) groups, such as cysteine residues in proteins. Conjugation can be performed at physiological pH. | price> |
R-C-5523 | C8 PEG Ceramide CAS:212116-76-2 | C8 PEG Ceramide CAS: 212116-76-2 is a product of sphingolipid metabolism, and its acyl chain length is different. For the research preparation of liposomes and preparation of PEGylated lipoplexes. | price> |
R-M2-9541 | DBCO-HSA | By attaching therapeutic agents to HSA via DBCO(DBCO-HSA/DBCO-human serum albumin/DBCO-Albumin from human serum/Human serum albumin-DBCO),the pharmacokinetics of the drug can be modified, leading to prolonged circulation times and targeted delivery to tissues expressing particular receptors or characteristics. DBCO is often used in bioconjugation strategies to covalently link proteins, peptides, or other biomolecules to HSA. This is particularly useful in developing targeted therapeutics or diagnostic agents. Conjugation of imaging agents (e.g., fluorescent markers, radioactive isotopes) to HSA through DBCO facilitates the tracking and visualization of biological processes in medical imaging techniques. HSA is sometimes used as a carrier for vaccine antigens. By conjugating antigens to HSA, the immune response can be improved due to the stable and biocompatible nature of the protein. HSA conjugates can also be used to deliver biologically active compounds, enzymes, or hormones effectively, targeting specific tissues or cells based on the characteristics of HSA and the associated payload. | price> |
R-M-7011 | IRDye® 680RD COOH | IRDye® 680RD Carboxylate can assays that use IRDye 680RD conjugates,such as small animal imaging and cell binding assays.Carboxylate (non-reactive) form of IRDye 680RD is an ideal control. | price> |
R-C-5524 | DSG-PEG cas:308805-39-2 | Phospholipids refer to lipids containing phosphoric acid and belong to the category of complex lipids. Phospholipids are the main component of biofilms, consisting of amphiphilic molecules with a hydrophilic nitrogen or phosphorus containing head at one end and a hydrophobic (lipophilic) long hydrocarbon chain at the other end. For this reason, the hydrophilic ends of phospholipid molecules are close to each other and the hydrophobic ends are close to each other, often forming a Lipid bilayer together with other molecules such as protein, glycolipids, cholesterol, etc. | price> |
R-M2-9542 | Mal-PEG4-trimethylammonium chloride | Mal-PEG4-trimethylammonium chloride is a versatile reagent that combines the benefits of maleimide-mediated bioconjugation with the properties of polyethylene glycol (PEG) and cationic trimethylammonium groups. The maleimide functionality allows for selective conjugation of fluorescent dyes, drugs, or other molecules to proteins, enabling their use in imaging, tracking, or therapeutic applications.The positively charged trimethylammonium can facilitate the formation of nanoparticles or complexes that enhance the delivery of nucleic acids (like DNA or RNA) or other therapeutics into cells. The compound can be used to create ADCs by linking a cytotoxic drug to an antibody via the maleimide group, allowing targeted delivery of the drug to cancer cells.It can be used to modify surfaces of medical devices or scaffolds to improve biocompatibility or enable further functionalization. | price> |
R-M-7012 | IRDye® 800RS NHS Ester | IRDye 800RS NHS ester is an excellent choice for nucleic acid applications. This near-infrared fluorescence dye has good water solubility, but low salt tolerance. It is more hydrophobic than IRDye 800CW.IRDye 800RS NHS ester can be used to label the primary and secondary amino groups of DNA and RNA. Nucleic acids that have been labeled with IRDye 800RS can be easily purified by reverse-phase chromatography. | price> |
R-C-5525 | DSPE-PEG2000-SS-RGD | DSPE stands for 1,2-distearoyl-sn-glycero-3-phosphoethanolamine,which is a phospholipid derivative commonly used in drug delivery systems.PEG2000 refers to polyethylene glycol 2000,a polymer that provides stability and solubility to the compound. SS can be cleaved in response to specific stimuli such as the presence of reducing agents. RGD is the abbreviation for the amino acid sequence Arg-Gly-Asp,which is a recognition motif for integrin receptors commonly found on cells. | price> |
R-M2-9543 | Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG | Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG/YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol is a sophisticated biomolecule consisting of cholesterol for membrane engagement, PEG for solubility and circulation enhancement, and a specific peptide for targeted delivery or bioactivity. Such conjugates are increasingly utilized in research and clinical applications, especially for drug delivery systems and targeted therapies, due to their inherent advantages in enhancing stability, providing targeting capabilities, and reducing side effects. | price> |
R-M-7013 | IRDye® QC-1 NHS Ester | IRDye QC-1 is the first non-fluorescent (dark) quencher compatible with a wide range of visible and near-infrared fluorophores (500-800 nm). It has the widest available quenching range, so you do not need to carefully match the donors fluorescence spectrum with the acceptors absorbance. IRDye QC-1 quenches common fluorophores with more than 97% efficiency1. | price> |
R-C-5526 | PLGA-TK-PEG-Biotin | PLGA refers to poly(lactic-co-glycolic acid), which is a biodegradable and biocompatible polymer commonly used in drug delivery systems. TK represents thymidine kinase, an enzyme involved in the metabolism of nucleosides. PEG stands for polyethylene glycol, a hydrophilic polymer that enhances the solubility and stability of the compound. Biotin is a vitamin that serves as a recognition moiety for binding to avidin or streptavidin, allowing for targeted delivery to cells expressing the avidin or streptavidin receptor. | price> |