Home > products > peg-derivatives
> peptide-pegs
> cholesterol-peg1000-ygmsprnrtgsnkpnciraiwptftepdg
Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG
YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M2-9543 | 25mg | 1238.00 | + Add to cart |
|
R-M2-9543 | 50mg | 2079.00 | + Add to cart |
|
|
Product description
Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG/YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol is a sophisticated biomolecule consisting of cholesterol for membrane engagement, PEG for solubility and circulation enhancement, and a specific peptide for targeted delivery or bioactivity. Such conjugates are increasingly utilized in research and clinical applications, especially for drug delivery systems and targeted therapies, due to their inherent advantages in enhancing stability, providing targeting capabilities, and reducing side effects.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Molecular formula | N/A |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product