Home > products  >  peg-derivatives 
					>  peptide-pegs
					>  cholesterol-peg1000-ygmsprnrtgsnkpnciraiwptftepdg
				
				Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG
 YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol
YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol
						| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product | 
|---|---|---|---|---|
| R-M2-9543 | 25mg | 1238.00 | + Add to cart | |
| R-M2-9543 | 50mg | 2079.00 | + Add to cart | |
|  | ||||
Product description
							Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG/YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol is a sophisticated biomolecule consisting of cholesterol for membrane engagement, PEG for solubility and circulation enhancement, and a specific peptide for targeted delivery or bioactivity. Such conjugates are increasingly utilized in research and clinical applications, especially for drug delivery systems and targeted therapies, due to their inherent advantages in enhancing stability, providing targeting capabilities, and reducing side effects.
| Appearance | N/A | 
|---|---|
| Molecular weight | N/A | 
| Purity | >90% | 
| Solubility | N/A | 
| Molecular formula | N/A | 
| Storage | -20℃, protected from light and moisture | 
| Transportation | 4-25℃ temperature for up to 3 weeks | 
| Stability | 1 year | 
Document
							Related Product
							
						
 Items-$0.00
Items-$0.00

 Email:
Email: Tel.:
Tel.: msds     of   YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol
msds     of   YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol  RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                    RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                 Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
                    Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China 
                 Tel:  02988811435
                    Tel:  02988811435
                 Fax: (86-29)8881-1435
                    Fax: (86-29)8881-1435
                 Email: sales@ruixibiotech.com
                    Email: sales@ruixibiotech.com
                 Web: http://www.ruixibiotech.com
                    Web: http://www.ruixibiotech.com    
					
							
                

