Catalog name Description price
R-C-7518 DSPE-PEG-HYD-mannose(cysteine)-CRLYLRIGRR DSPE-PEG-HYD-mannose(cysteine)-CRLYLRIGRR is a highly functional composite molecule that combines various characteristics such as lipid anchoring,pH responsive linkage,sugar targeting, thiol modification,and peptide targeting,and can be used to construct intelligent nanocarriers.This product is only for scientific research and cannot be used on the human body. price>
R-C-7519 DSPE-PEG-GIRLRG(Gly-Ile-Arg-Leu-Arg-Gly-OH) DSPE-PEG2000-GIRLRG,GIRLRG-PEG-DSPE,DSPE-PEG-Gly-Ile-Arg-Leu-Arg-Gly-OH,DSPE-PEG-GIRLRG is a functionalized phospholipid complex molecule,which serves as the basic skeleton and provides an amphiphilic structure that can be embedded into liposomes or micelles.The PEG segments enhance water solubility and in vivo circulation time,reducing immune clearance. Hexapeptides contain two positively charged arginine(Arg)residues and have strong cell penetration potential,possibly belonging to the family of cell penetrating peptides(CPP)or tumor targeting peptides.This product is only for scientific research and cannot be used on the human body. price>
R-C-7520 DSPE-PEG-GPQGIWGQ-Acrylamide DSPE-PEG2K-GPQGIWGQ-Acrylamide,DSPE-PEG serves as the basic skeleton,providing an amphiphilic structure that can be embedded into liposomes or micelles.The PEG segments enhance water solubility and in vivo circulation time,reducing immune clearance.GPQGIWGQ,as a peptide,contains hydrophilic residues of glutamic acid and glycine,making it highly water-soluble,especially in neutral and slightly alkaline environments Acrylamide serves as a polymerizable functional group.This product is only for scientific research and cannot be used on the human body. price>
R-C-7521 DSPE-PEG-Tet1(HLNILSTLWKYR) Tet1(HLNILSTLWKYR)-PEG2K-DSPE,DSPE-PEG-HLNILSTLWKYR,The Tet1 peptide(HLNILSTLWKYR)is linked to the end of the DSPE-PEG molecule to form DSPE-PEG-Tet1.Tet1 is a specific peptide fragment that can recognize specific types of cell surface receptors in the nervous system,giving the carrier a certain targeting ability at the cellular level.This design enables lipid polymer composites to not only exist stably in aqueous or bodily fluids,but also to more accurately approach or enter specific cells.This product is only for scientific research and cannot be used on the human body. price>
R-C-7523 DSPE-PEG-KPSSPPEECGPLGIAGQC KPSSPPEECGPLGIAGQC-PEG-DSPE,DSPE-PEG-A6(KPSSPPEECGPLGIAGQC),DSPE-PEG-KPSSPPEECGPLGIAGQC is a functionalized phospholipid complex, in which the peptide sequence KPSSPPPEECGPLGIAGQC(A6 peptide)is linked to the DSPE lipid anchoring group via a PEG segment.DSPE(di stearoyl phosphatidylethanolamine)as a hydrophobic tail can be embedded in liposomes,micelles,or cell membranes;PEG(polyethylene glycol)serves as a hydrophilic linking arm,providing steric hindrance,prolonging in vivo circulation time,and reducing immunogenicity. price>
R-C-5944 DSPE-PEG2k-CGPLGVRGDK-DBCO DBCO(Dibenzylcyclooctyne) reagents can be used to label azide-modified biomolecules spontaneous without the need for toxic Cu catalysts.The reaction of azides with strained alkynes,such as cyclooctynes, readily forms a triazole product without the need for a toxic catalystPEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins.It can also suppress the non-specific binding of charged molecules to the modified surfaces.It can also couple various peptides. price>
R-C-7525 DSPE-Hyd-PEG-CAIX DSPE-Hyd-PEG-CAIX is a functionalized phospholipid targeted conjugate,and its structure includes hydrophilic and hydrophobic regions,which helps to form stable assemblies.CAIX is a transmembrane protein highly expressed in a variety of solid tumors(such as kidney cancer, breast cancer,colorectal cancer),a key regulator of tumor microenvironment acidification,and an important tumor targeting marker.This product is only for scientific research and cannot be used on the human body. price>
R-C-7526 DSPE-GNYTCEVTELSREGKTVIELK GNYTCEVTELSREGKTVIELK-DSPE,DSPE as a lipid anchoring group,can stably embed into the bilayer of liposomes,lipid nanoparticles(LNP),or cell membranes, providing structural integration capability.GNYTCEVTELSREGKTIELK is a mimic peptide sequence of CD47 protein,which can bind to the signal regulatory protein alpha(SIRP alpha)on the surface of macrophages,transmit self recognition signals,inhibit phagocytosis,and prolong the circulation time of nanocarriers in vivo.This product is only for scientific research and cannot be used on the human body. price>
R-C-7527 DSPE-PEG-GNYTCEVTELSREGKTVIELK DSPE-PEG2K-GNYTCEVTELSREGKTVIELK,GNYTCEVTELSREGKTVIELK-PEG-DSPE,DSPE-PEG-CD47,DSPE-PEG-GNYTCEVTESREGKTIELK is a functionalized phospholipid conjugate.DSPE acts as a hydrophobic tail and can be embedded into liposomes, micelles, or cell membranes.PEG (polyethylene glycol)acts as a hydrophilic linking arm,providing steric hindrance,prolonging in vivo circulation time,and reducing immunogenicity.GNYTCEVTELSREGKTIELK is a functional mimic peptide of CD47 protein,which can bind to the SIRP α receptor on the surface of macrophages, transmit the dont eat mesignal,significantly inhibit phagocytosis,and improve the in vivo stability and targeted enrichment efficiency of nanocarriers.This product is only for scientific research and cannot be used on the human body. price>
R-C-7529 DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR ‌DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR‌ is a highly functionalized phospholipid polyethylene glycol peptide conjugate designed for efficient delivery of biomolecules(such as CRISPR RNP complexes,siRNA,or proteins)into specific cells(especially T cells).This molecule combines multiple mechanisms including lipid anchoring,long circulation protection,membrane fusion penetration,and nuclear localization.This product is only for scientific research and cannot be used on the human body. price>