Home > products > phospholipids
> phospholipid-peg-customization
> dspe-peg-cglfekiegfiengwegmidgwygygrkkrrqrr
DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
|---|---|---|---|---|
| R-C-7529 | 50mg | 969.00 | + Add to cart |
|
| R-C-7529 | 100mg | 1655.00 | + Add to cart |
|
|
||||
Product description
DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR is a highly functionalized phospholipid polyethylene glycol peptide conjugate designed for efficient delivery of biomolecules(such as CRISPR RNP complexes,siRNA,or proteins)into specific cells(especially T cells).This molecule combines multiple mechanisms including lipid anchoring,long circulation protection,membrane fusion penetration,and nuclear localization.This product is only for scientific research and cannot be used on the human body.
| Appearance | N/A |
|---|---|
| PEG Molecular Weight | 1000,2000,3400,5000,10000 Dalton |
| Solubility | N/A |
| Purity | N/A |
| Transportation | 4-25℃ temperature for up to 3 weeks |
| Storage | -20℃, protected from light and moisture |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds---DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


