X
Email:
sales@ruixibiotech.com

DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR

1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-C-7529 50mg 969.00
- +
+ Add to cart
R-C-7529 100mg 1655.00
- +
+ Add to cart
  •     PEG Molecular Weight    
  •   

Product description

‌DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR‌ is a highly functionalized phospholipid polyethylene glycol peptide conjugate designed for efficient delivery of biomolecules(such as CRISPR RNP complexes,siRNA,or proteins)into specific cells(especially T cells).This molecule combines multiple mechanisms including lipid anchoring,long circulation protection,membrane fusion penetration,and nuclear localization.This product is only for scientific research and cannot be used on the human body.


Appearance N/A
PEG Molecular Weight 1000,2000,3400,5000,10000 Dalton
Solubility N/A
Purity N/A
Transportation 4-25℃ temperature for up to 3 weeks
Storage -20℃, protected from light and moisture
Stability 1 year
Document

Related Product