| Catalog | name | Description | price |
|---|---|---|---|
| R-M2-9532 | DMG-PEG2000-RGD | DMG-PEG2000-RGD/1,2-Dimyristoyl-sn-glycerol-methoxypolyethylene glycol2000-RGD could be used to develop targeted drug delivery systems. The PEG component helps in stabilizing the formulation and prolonging its circulation time, while the RGD sequence can enhance the targeting of the drug to specific cells (like cancer cells) expressing integrin receptors.This conjugate may be used in the creation of bioconjugates for diagnostics or therapeutics, where the RGD promotes selective binding to target tissues or cells. In tissue engineering, RGD is often incorporated into scaffolds to promote cell adhesion and tissue regeneration. | price> |
| R-M2-9534 | DSG-PEG2000-CRPPR | DSG-PEG2000-CRPPR/Distearoyl-rac-glycerol-PEG2000-CRPPR/DSG-PEG2000-CRPPR is a multifunctional compound ideal for applications in targeted drug delivery, vaccine development, and tissue engineering. Its structure incorporates a lipid portion for membrane interactions, a PEG moiety for enhanced solubility and circulation time, and a peptide for targeted delivery, making it a valuable component in modern biomedical research and applications. | price> |
| R-M2-9540 | SH-PEG1k-RKRLQVQLSIRT | SH-PEG1k-RKRLQVQLSIRT/Thiol-PEG1k-RKRLQVQLSIRT/RKRLQVQLSIRT-PEG1k-Thiol/RKRLQVQLSIRT-PEG1k-SH is a versatile and functional peptide conjugate suitable for various applications in drug delivery, diagnostics, and research. The combination of the thiol group, PEG spacer, and a biologically active peptide sequence enhances the potential for targeted treatments and studies in molecular biology and therapeutic development. | price> |
| R-M2-9543 | Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG | Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG/YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol is a sophisticated biomolecule consisting of cholesterol for membrane engagement, PEG for solubility and circulation enhancement, and a specific peptide for targeted delivery or bioactivity. Such conjugates are increasingly utilized in research and clinical applications, especially for drug delivery systems and targeted therapies, due to their inherent advantages in enhancing stability, providing targeting capabilities, and reducing side effects. | price> |
| R-M2-9544 | DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG | DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG is a versatile molecule potentially applicable in various scientific and medical fields.It could be utilized for effective drug delivery, targeted therapy, or research into cell biology and interactions. | price> |
| R-M2-9545 | Cholesterol-PEG2000-RVG29PPP(D-RVG29) | Cholesterol-PEG2000-RVG29PPP(D-RVG29) represents a promising strategy for targeted therapeutics, primarily in neurological contexts.The conjugate can encapsulate and deliver various therapeutic agents (small molecules, peptides, nucleic acids) directly to neuronal tissues. Given the ability of RVG29 to cross the blood-brain barrier, this conjugate could be used to treat neurodegenerative diseases (like Alzheimer’s or Parkinson’s disease) or CNS tumors.Can potentially be utilized to deliver genetic materials (such as siRNA or plasmids) into neural cells to address genetic disorders or modulate gene expression.Potential applications in neuroimaging or as a vector for imaging agents to enhance the detection of CNS disorders. | price> |
| R-M2-9546 | DMG-PEG2000-RVG29PPP(D-RVG29) | The DMG-PEG2000-RVG29PPP(D-RVG29) construct represents a sophisticated approach to enhance drug delivery systems, particularly for targeting the central nervous system. The integration of DMG with PEG and RVG29 allows for improved solubility and specific targeting abilities, making this construct suitable for a wide range of therapeutic applications in CNS disorders. Potential use in imaging techniques for neurological conditions, acting as a vector for radiolabeled compounds or contrast agents to enhance visualization in medical imaging. | price> |
| R-M2-9547 | Cholesterol-PEG-CD38(ARGDYYGSNSLDYW) | The Cholesterol-PEG-CD38(ARGDYYGSNSLDYW) construct represents a sophisticated approach for drug delivery, combining the cellular targeting capabilities of a peptide with the solubility-enhancing properties of PEG and the membrane fusion properties of cholesterol. Its design allows for specific applications in therapeutic and diagnostic fields, primarily within oncology and immunology.Cholesterol-PEG-CD38(ARGDYYGSNSLDYW)could be employed to deliver chemotherapeutic agents specifically to tumor cells expressing CD38, allowing for localized therapy with reduced systemic toxicity.It can be used in the formulation of vaccines where targeting immune cells is necessary to enhance vaccine efficacy. | price> |
| R-M2-9548 | DMG-PEG-CD38 | DMG-PEG-CD38/DMG-PEG-ARGDYYGSNSLDYW is a multifunctional conjugate that utilizes the benefits of lipid modification, PEGylation, and a targeting peptide sequence to improve the delivery of therapeutic agents. Targeting peptides, in particular, are powerful tools in modern therapeutic strategies, enabling the development of more effective and less toxic treatment options. Further development and optimization of this conjugate could advance its use in targeted drug delivery, diagnostic applications, or therapeutic innovations. | price> |
| R-M2-9555 | DMG-PEG2000-WMVLPWLPGTLDGGSGCR | DMG-PEG2000-WMVLPWLPGTLDGGSGCR is a multifunctional compound comprising PEG for improved pharmacokinetics, a DMG component for solubility and stability, and a specific peptide sequence for targeting or therapeutic action. This combination of elements makes it suitable for research and development in the fields of biomedicine, drug delivery, and peptide therapeutics. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


