Product peg-derivatives -peptide-pegs

Home > products > peg-derivatives > peptide-pegs

Catalog	name	Description	price
R-M2-9527	GGAAKC-TK-mPEG2000	GGAAKC-TK-mPEG2000/mPEG2000-TK-GGAAKC is a versatile bioconjugate that combines a peptide suitable for targeting, an important enzyme for therapeutic activation, and a PEG polymer that can enhance the delivery and efficacy of that therapy. The specific properties and functions of each component enable a wide range of potential applications in drug delivery, cancer treatment, biotechnology, and virology.	price>
R-M2-9531	SH-PEG1k-c(RGDfK)	SH-PEG1k-cRGDfk/Thiol-PEG1k-cRGDfk/SH-PEG1k-c(RGDfK) could be used for targeted drug delivery, particularly in cancer therapy. The RGD peptide can help direct the conjugate to integrin-expressing cells, while the PEGylation can improve pharmacokinetics and reduce immunogenicity.	price>
R-M2-9532	DMG-PEG2000-RGD	DMG-PEG2000-RGD/1,2-Dimyristoyl-sn-glycerol-methoxypolyethylene glycol2000-RGD could be used to develop targeted drug delivery systems. The PEG component helps in stabilizing the formulation and prolonging its circulation time, while the RGD sequence can enhance the targeting of the drug to specific cells (like cancer cells) expressing integrin receptors.This conjugate may be used in the creation of bioconjugates for diagnostics or therapeutics, where the RGD promotes selective binding to target tissues or cells. In tissue engineering, RGD is often incorporated into scaffolds to promote cell adhesion and tissue regeneration.	price>
R-M2-9534	DSG-PEG2000-CRPPR	DSG-PEG2000-CRPPR/Distearoyl-rac-glycerol-PEG2000-CRPPR/DSG-PEG2000-CRPPR is a multifunctional compound ideal for applications in targeted drug delivery, vaccine development, and tissue engineering. Its structure incorporates a lipid portion for membrane interactions, a PEG moiety for enhanced solubility and circulation time, and a peptide for targeted delivery, making it a valuable component in modern biomedical research and applications.	price>
R-M2-9540	SH-PEG1k-RKRLQVQLSIRT	SH-PEG1k-RKRLQVQLSIRT/Thiol-PEG1k-RKRLQVQLSIRT/RKRLQVQLSIRT-PEG1k-Thiol/RKRLQVQLSIRT-PEG1k-SH is a versatile and functional peptide conjugate suitable for various applications in drug delivery, diagnostics, and research. The combination of the thiol group, PEG spacer, and a biologically active peptide sequence enhances the potential for targeted treatments and studies in molecular biology and therapeutic development.	price>
R-M2-9543	Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG	Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG/YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol is a sophisticated biomolecule consisting of cholesterol for membrane engagement, PEG for solubility and circulation enhancement, and a specific peptide for targeted delivery or bioactivity. Such conjugates are increasingly utilized in research and clinical applications, especially for drug delivery systems and targeted therapies, due to their inherent advantages in enhancing stability, providing targeting capabilities, and reducing side effects.	price>
R-M2-9544	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG is a versatile molecule potentially applicable in various scientific and medical fields.It could be utilized for effective drug delivery, targeted therapy, or research into cell biology and interactions.	price>
R-M1-8215	Cholesterol-PEG-FCIGRLGGGGGGC	Cholesterol-PEG-FCIGRLGGGGGGC is a bifunctional peptide modified peg reagent.	price>
R-M1-8221	DMG-PEG2K-PKTRNSQTQTDRRRRRRRR	DMG-PEG2K-PKTRNSQTQTDRRRRRRRR is a Peptide modified heterobifunctional peg reagent.	price>
R-M1-8246	c(RGDfK)-PEG2-MAL	C(RGDfK)-PEG2-MAL is a cyclic peptide modified heterobifunctional peg reagent.	price>

...