Home > Keywords > 
Catalog name Description price
R-C-3463 DSPE-PEG550-MC-DA7R MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB, target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively. price>
R-R-5133 1,2-Benzenedicarbonitrile, 4,5-dimethyl- CAS No.:36360-43-7 1,2-Benzenedicarbonitrile, 4,5-dimethyl- (BDMD)/CAS No.:36360-43-7 is an organic compound with a wide range of applications in scientific research. BDMD is a versatile compound used in the synthesis of organic compounds, and its properties make it an important tool in laboratory experiments. BDMD has been used in a variety of scientific research applications, including drug development and the study of biological systems. Please inquire in advance to purchase this product. price>
R-M-990 β-Neoendorphin,CAS : 77739-21-0 A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay. price>
R-C-3464 MC-DA7R-PEG750-DSPE MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB,target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively. price>
R-R-5134 Thieno[3,2-b]thiophene-2,5-dicarbaldehyde CAS No.:37882-75-0 Thieno[3,2-b]thiophene-2,5-dicarbaldehyde/CAS No.:37882-75-0 is a chemical compound with the empirical formula C8H4O2S2 . It is used as a monomer in the synthesis of Covalent Organic Frameworks (COFs) materials . This molecule has been used in the synthesis of novel metal-free organic dyes for Dye-Sensitized Solar Cells, reaching conversion efficiencies of 6.23% . Please inquire in advance to purchase this product. price>
R-M-991 Nesfatin-1 (human) trifluoroacetate salt,CAS : 917528-35-9 Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research. price>
R-C-3465 GLP-1-polyethylene glycol350-DSPE Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification. price>
R-R-5135 Naphthalene-1,4-dicarbaldehyde CAS No.:38153-01-4 Naphthalene-1,4-dicarbaldehyde/CAS No.:38153-01-4, a chemical compound, is widely used in scientific research due to its diverse applications. This versatile material finds use in organic synthesis, fluorescent labeling, and as a building block for various functional molecules. Its unique properties make it a valuable tool in numerous scientific investigations. Please inquire in advance to purchase this product. price>
R-M-992 Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research. price>
R-C-3466 Glucagon like peptide-1-PEG550-DSPE Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification. price>
R-R-5136 9,10-Anthracenedicarboxaldehyde CAS No.:7044-91-9 9,10-Anthracenedicarboxaldehyde/CAS No.:7044-91-9, also known as Anthracene-9,10-dicarbaldehyde, is an acene-9,10-dialdehyde and an anthracenedialdehyde . It is an aggregation-induced emission luminogens (AIEgens) and is used as a reagent in the preparation of porous imine-linked networks (PINs) . Please inquire in advance to purchase this product. price>
R-M-993 Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8 Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. price>
R-C-3467 GLP-1-PEG750-DSPE Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification. price>
R-R-5137 2,5-Thiophenedicarboxaldehyde CAS No.:932-95-6 2,5-Thiophenedicarboxaldehyde/CAS No.:932-95-6 is a reagent used in the synthesis of N,N-bis-(mercaptophenylimine)thiophenedicarboxaldehyde Schiff base and functions as an intermediate in many organic syntheses . It is also a natural product found in Capparis spinosa . Please inquire in advance to purchase this product. price>
R-M-994 nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9 Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment. price>
R-C-3468 HP2 targeting peptide-PEG350-DSPE HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology. price>
R-R-5138 [2,2-Bipyridine]-4,4-dicarbaldehyde CAS No.:99970-84-0 [2,2-Bipyridine]-4,4-dicarbaldehyde/CAS No.:99970-84-0 is an intriguing chemical compound used in various scientific research applications. Its unique structure and properties make it suitable for diverse studies, ranging from catalysis to material science. Please inquire in advance to purchase this product. price>
R-M-995 Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 from ruixi. It is a synthetic peptide.It can be used for Obesity Research. price>
R-C-3469 HP2-polyethylene glycol550-DSPE HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology. price>
R-R-5139 (E)-(diazene-1,2-diylbis(4,1-phenylene))diboronic acid CAS No.:1902168-17-5 (E)-(diazene-1,2-diylbis(4,1-phenylene))diboronic acid/CAS No.:1902168-17-5 is a compound with notable optical and nonlinear optical properties, and it is of interest in the field of materials science for its potential applications in various technologies. Please inquire in advance to purchase this product. price>