Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-C-3466 | Glucagon like peptide-1-PEG550-DSPE | Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification. | price> |
| R-R-5136 | 9,10-Anthracenedicarboxaldehyde CAS No.:7044-91-9 | 9,10-Anthracenedicarboxaldehyde/CAS No.:7044-91-9, also known as Anthracene-9,10-dicarbaldehyde, is an acene-9,10-dialdehyde and an anthracenedialdehyde . It is an aggregation-induced emission luminogens (AIEgens) and is used as a reagent in the preparation of porous imine-linked networks (PINs) . Please inquire in advance to purchase this product. | price> |
| R-M-993 | Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8 | Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. | price> |
| R-C-3467 | GLP-1-PEG750-DSPE | Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification. | price> |
| R-R-5137 | 2,5-Thiophenedicarboxaldehyde CAS No.:932-95-6 | 2,5-Thiophenedicarboxaldehyde/CAS No.:932-95-6 is a reagent used in the synthesis of N,N-bis-(mercaptophenylimine)thiophenedicarboxaldehyde Schiff base and functions as an intermediate in many organic syntheses . It is also a natural product found in Capparis spinosa . Please inquire in advance to purchase this product. | price> |
| R-M-994 | nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9 | Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment. | price> |
| R-C-3468 | HP2 targeting peptide-PEG350-DSPE | HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology. | price> |
| R-R-5138 | [2,2-Bipyridine]-4,4-dicarbaldehyde CAS No.:99970-84-0 | [2,2-Bipyridine]-4,4-dicarbaldehyde/CAS No.:99970-84-0 is an intriguing chemical compound used in various scientific research applications. Its unique structure and properties make it suitable for diverse studies, ranging from catalysis to material science. Please inquire in advance to purchase this product. | price> |
| R-M-995 | Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 | Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 from ruixi. It is a synthetic peptide.It can be used for Obesity Research. | price> |
| R-C-3469 | HP2-polyethylene glycol550-DSPE | HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology. | price> |
| R-R-5139 | (E)-(diazene-1,2-diylbis(4,1-phenylene))diboronic acid CAS No.:1902168-17-5 | (E)-(diazene-1,2-diylbis(4,1-phenylene))diboronic acid/CAS No.:1902168-17-5 is a compound with notable optical and nonlinear optical properties, and it is of interest in the field of materials science for its potential applications in various technologies. Please inquire in advance to purchase this product. | price> |
| R-M-996 | Nesfatin-1-Like Peptide (mouse) trifluoroacetate salt | The insulinotropic peptide encoded by nucleobindin 1 upregulated preproinsulin mRNA expression and insulin secretion. | price> |
| R-C-3470 | HP2-PEG750-DSPE | HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology. | price> |
| R-R-5140 | Boronic acid, (nitrilotri-4,1-phenylene)tris- CAS No.:245737-33-1 | Boronic acid, (nitrilotri-4,1-phenylene)tris-/CAS No.:245737-33-1, is a versatile chemical compound used in scientific research. It offers diverse applications due to its unique properties, aiding in various fields of study such as drug delivery systems, bioimaging, and sensor development. Please inquire in advance to purchase this product. | price> |
| R-M-997 | Neural-Cadherin (76-85) amide (chicken),CAS:127650-08-2 | This decapeptide resides within the first extracellular domain (EC1) of N-cadherin. It inhibits cadherin-mediated cell adhesion, compaction of eight-cell-stage mouse embryos and rat neurite outgrowth on astrocytes. In the presence of this peptide Ca²⁺-dependent cell aggregation of bovine brain microvessel endothelial cells is prevented. A putative application in creating channels for paracellular drug delivery across blood brain barriers has been proposed. | price> |
| R-C-3471 | DSPE-PEG350-CGKRKb targeting polypeptide | (DSPE) conjugated polyethylene glycol is a combination of phospholipids and polyethylene glycol, which has hydrophilicity and hydrophobicity. Polyethylene glycol phospholipid liposomes form high-quality materials, which can be used for drug delivery, gene transfection and vaccine delivery. Pegylated phospholipids can significantly improve blood circulation time and stabilize drug encapsulation. These materials can also be used for targeted drug delivery by modifying ligands with target surfaces, such as antibodies and peptides. | price> |
| R-R-5141 | (9,9-Dimethyl-9H-fluorene-2,7-diyl)diboronic acid CAS No.:866100-14-3 | (9,9-Dimethyl-9H-fluorene-2,7-diyl)diboronic acid/CAS No.:866100-14-3 is a compound that belongs to the class of fluorene derivatives, which are known for their luminescent properties and practical value, particularly in the field of organic light-emitting diode (OLED) materials. The compound features a fluorene backbone substituted with two boronic acid groups at the 2,7-positions and two methyl groups at the 9-position, which may influence its electronic properties and reactivity. Please inquire in advance to purchase this product. | price> |
| R-M-998 | Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt,CAS : 954420-51-0 | Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt ,CAS:954420-51-0 from ruixi.It can be used in the study of Parkinson disease. | price> |
| R-C-3472 | DSPE-polyethylene-glycol550-CGKRKb | (DSPE) conjugated polyethylene glycol is a combination of phospholipids and polyethylene glycol, which has hydrophilicity and hydrophobicity. Polyethylene glycol phospholipid liposomes form high-quality materials, which can be used for drug delivery, gene transfection and vaccine delivery. Pegylated phospholipids can significantly improve blood circulation time and stabilize drug encapsulation. These materials can also be used for targeted drug delivery by modifying ligands with target surfaces, such as antibodies and peptides. | price> |
| R-R-5142 | 3-Hexene-1,5-diyne, 3,4-diethynyl- CAS No.:133968-85-1 | 3-Hexene-1,5-diyne, 3,4-diethynyl-/CAS No.:133968-85-1 is a chemical compound used in various scientific research applications. Its unique structure allows for diverse experimentation, aiding in the development of new materials and potential advancements in fields like medicine and renewable energy. Please inquire in advance to purchase this product. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


