Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-C-6105	PI(4)P diC16 CAS:214332-61-3	D-myo-Phosphatidylinositol 4-phosphate,Dipalmitoyl Phosphatidylinositol 4-phosphate,PtdIns(4)P C16, PI(4)P C16, or PI4P,Phosphatidylinositol 4-phosphate diC16(PI(4)P diC16)is a synthetic,purified dipalmitoyl PI(4)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex.	price>
R-M2-10122	DBCO-E7	DBCO-E7 peptide (GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) is an E7 derived peptide modified with DBCO (dibenzocyclooctyne), mainly used for biological coupling and targeting research. Application Scenario: Drug delivery: Can be coupled with drugs or nanoparticles for targeted therapy of HPV related tumors. Imaging and Diagnosis: Used to label fluorescent or radioactive probes to assist in disease diagnosis. Mechanism research: Help to elucidate the role of E7 protein in tumorigenesis.	price>
R-C-7685	SH-PEG550-b-pHis2k	SH-PEG550-b-pHis2k is an amphiphilic block copolymer composed of short chain polyethylene glycol(PEG550)with a thiol group(SH)at one end and polyhistidine(pHis2k)blocks. It is mainly used for the construction of nanocarriers and pH responsive delivery systems.	price>
R-M1-8488	FITC-adipic acid	FITC-Adipic acid can be used in various research areas, such as studying metabolic processes, analyzing metabolic pathways, or investigating the metabolism of adipic acid in organisms or cells.FITC-Adipic acid is a useful tool for visualizing and detecting adipic acid in biological samples using fluorescence-based techniques.	price>
R-C-6106	PI(4)P diC4 CAS:790192-01-7	D-myo-Phosphatidylinositol 4-phosphate,Dibutanoyl Phosphatidylinositol 4-phosphate, PtdIns(4)P C4, PI(4)P C4,or PI4P,Phosphatidylinositol 4-phosphate diC4 (PI(4)P diC4) is a synthetic, purified dibutanoyl PI(4)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex.	price>
R-M2-10123	C18-CpG-CY5	C18-CpG-CY5/C18-Thio DNA (CpG1018)-CY5 is a fluorescently labeled immunostimulant primarily used in vaccine adjuvant research and immune activation experiments. This product is only for scientific research and cannot be used on the human body.	price>
R-C-7686	PLGA-TK-PMPC	PLGA-TK-PMPC is a redox responsive amphiphilic block copolymer designed for use in the biomedical field. The PMPC block can reduce immunogenicity,decrease the phagocytosis of the carrier by the reticuloendothelial system,and enhance drug tumor enrichment efficiency. Ketothiol bonds are only broken at high ROS concentrations,which can accurately respond to pathological microenvironments such as tumors and inflammation,reducing drug toxicity and side effects in normal tissues.PLGA blocks can be hydrolyzed into non-toxic metabolites in vivo and ultimately excreted through the kidneys,with high biological safety.	price>
R-M1-8489	DMG-PEG-R8	DMG-PEG-R8,DMG-PEG-octaarginine for enhanced delivery of a bioactive molecule into cells. The PEG2K component may contribute to improved stability and solubility, while the R8 component may aid in cellular uptake.	price>
R-C-6107	PI(4)P diC8 CAS:214069-07-5	D-myo-Phosphatidylinositol 4-phosphate,Dioctanoyl Phosphatidylinositol 4-phosphate, PtdIns(4)P C8,PI(4)P C8, 8:0/8:0 PI(4)P,Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex.	price>
R-M2-10124	E7(EPLQLKM)-peg-DMG	E7(EPLQLKM)-peg-DMG/DMG-peg-E7(EPLQLKM)/-peg-DMG is an E7 derived peptide modified with PEG-DMG (di nutmeg glycerol polyethylene glycol), mainly used for targeted drug delivery and biological coupling research. Application: Targeted therapy: can be used in combination with chemotherapy drugs or siRNA for targeted therapy of HPV related tumors. Immune regulation: used in vaccine adjuvants or immunotherapy research, by activating the TLR pathway or regulating immune cell function. Biocoupling: As a connecting arm, it is used to construct peptide drug conjugates (PDCs) or nanocarriers.	price>
R-C-7687	DSPE-PEG-VYQFF	VYQFF-PEG-DSPE,The hydrophobic end DSPE (di stearoyl phosphatidylethanolamine) provides lipid membrane anchoring ability, and the middle PEG chain acts as a hydrophilic flexible spacer arm. The specific recognition ability of VYQFF peptide segment enables targeted delivery, while the PEG chain can reduce non-specific adsorption of the carrier in vivo and prolong the circulating half-life.	price>
R-M1-8490	DMG-PEG-RB	DMG-PEG-RB,1,2-Dimyristoyl-sn-glycerol-methoxypolyethylene glycol-Rhodamine B from ruixibio.The combination of DMG, PEG, and RB in DMG-PEG-RB for specific applications such as enhanced cellular uptake or targeted delivery of a bioactive molecule. The PEG2000 component may contribute to improved solubility, while the RB component can enable fluorescence-based visualization or tracking of the delivered molecule.	price>
R-C-6108	PI(5)P diC16 CAS:219527-75-8	D-myo-Phosphatidylinositol 5-phosphate,Dipalmitoyl Phosphatidylinositol 5-phosphate,PtdIns(5)P C16, PI(5)P C16,or PI5P,Phosphatidylinositol 5-phosphate diC16(PI(5)P diC16)is a synthetic,purified dipalmitoyl PI(5)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10125	CY5-CpG(TCGAACGTTCGAACGTTCGAACGTTCGAAT)	CY5-CpG(TCGAACGTTCGAACGTTCGAACGTTCGAAT) is a type B CpG oligonucleotide with fluorescent labeling. Its core function is to activate the immune response through the TLR9 pathway, and it is commonly used in vaccine adjuvants and immunotherapy research. Application Scenario: Vaccine adjuvant: enhances antigen immunogenicity and reduces dosage. Immunotherapy: Used in combination with chemotherapy and radiotherapy to improve the tumor microenvironment. Mechanism research: Analyze the TLR9 signaling pathway and immune cell activation mechanism.	price>
R-C-7688	DSPE-PEG-CRYYRITY	CRYYRITY-PEG-DSPE,The application of DSPE-PEG-CRYYIRITY mainly involves encapsulating drugs in nanocarriers,utilizing the characteristics of DSPE and PEG to improve drug stability and bioavailability,and achieving targeted delivery to specific cells or tissues through CRYYIRITY sequences.This method can reduce the damage of drugs to normal tissues and improve treatment effectiveness.	price>
R-M1-8491	CY5-PEG-iRGD	CY5-PEG-iRGD is a compound designed for targeted delivery and imaging in cancer research. It consists of three components: CY5, a red fluorescent dye for visualization purposes; PEG, a biocompatible polymer that enhances stability and biocompatibility; and iRGD, a peptide sequence that specifically targets tumor cells.	price>
R-C-6109	PI(5)P diC4	D-myo-Phosphatidylinositol 5-phosphate,Dibutanoyl Phosphatidylinositol 5-phosphate,PtdIns(5)P C4, PI(5)P C4,or PI5P,Phosphatidylinositol 5-phosphate diC4 (PI(5)P diC4)is a synthetic, purified dibutanoyl PI(5)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10126	DMG-GPQGIAGQR-PEG-CpG-ODN	DMG-GPQGIAGQR-PEG-CpG-ODN is a CpG oligonucleotide modified with PEG and DMG, mainly used in vaccine adjuvant and immunotherapy research. Application: Vaccine adjuvant: can enhance the immunogenicity of vaccines and reduce antigen dosage. Immunotherapy: Used in combination with chemotherapy and radiotherapy to improve the tumor microenvironment. Mechanism research: Used to analyze the TLR9 signaling pathway and immune cell activation mechanism.	price>
R-M1-8492	Tetracycline-OVA	Tetracycline-OVA/OVA Conjugated Tetracycline (TTC)/Tetracycline [OVA] /Tetracycline (TTC) Protein (OVA)/Tetracycline protein (OVA) refers to the conjugation of Tetracycline with Ovalbumin (OVA). Tetracycline is a widely used antibiotic medication that belongs to the class of tetracycline antibiotics. Ovalbumin, on the other hand, is a protein found in egg whites and is commonly used as an antigen in immunological research.	price>
R-C-6110	PI(5)P diC8 CAS:291527-92-9	Dioctanoyl Phosphatidylinositol 5-phosphate,PtdIns(5)P C8,PI(5)P C8, or PI5P,Dioctanoyl Phosphatidylinositol 5-phosphate,PtdIns(5)P C8,PI(5)P C8,or PI5P,Phosphoinositides (PIPns) are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 5-phosphate (PI(5)P) is a rare lipid found in the nucleus that can bind the PHD finger of the nuclear adapter protein ING2.PI(5)P is phosphorylated to PI(4,5)P2 by Type II PIP kinases.	price>

114611471148114911501151 11521153115411551156