Urotensin I,Cas:83930-33-0
Urotensin I
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-274 | 1mg | 200.00 | + Add to cart |
|
R-M-274 | 5mg | 800.00 | + Add to cart |
|
|
Product description
Urotensin-I was first isolated from the urophysis of the white sucker, and has been shown to decrease blood pressure in the rat. The type-2 CRH receptor has a high affinity with UI compared to CRH. UI stimulates adrenocorticotropic hormone (ACTH) release. UI is involved in the adaptability of fishes regarding, for example, ion and fluid equilibrium, cardiovascular activity, and inter-renal tissue glucocorticoid release.Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | Soluble in water |
Cas | 83930-33-0 |
Sequence | H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 / NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 |
C Terminal | NH2 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product