X
Email:
sales@ruixibiotech.com

Urotensin I,Cas:83930-33-0

Urotensin I

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-274 1mg 200.00
- +
+ Add to cart
R-M-274 5mg 800.00
- +
+ Add to cart

Product description

Urotensin-I was first isolated from the urophysis of the white sucker, and has been shown to decrease blood pressure in the rat.  The type-2 CRH receptor has a high affinity with UI compared to CRH. UI stimulates adrenocorticotropic hormone (ACTH) release. UI is involved in the adaptability of fishes regarding, for example, ion and fluid equilibrium, cardiovascular activity, and inter-renal tissue glucocorticoid release.Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor.


Appearance N/A
Molecular weight N/A
Purity >95%
Solubility Soluble in water
Cas 83930-33-0
Sequence H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 /  NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
C Terminal NH2
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product