Urotensin I,Cas:83930-33-0
 Urotensin I
Urotensin I
						| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product | 
|---|---|---|---|---|
| R-M-274 | 1mg | 200.00 | + Add to cart | |
| R-M-274 | 5mg | 800.00 | + Add to cart | |
|  | ||||
Product description
							Urotensin-I was first isolated from the urophysis of the white sucker, and has been shown to decrease blood pressure in the rat. The type-2 CRH receptor has a high affinity with UI compared to CRH. UI stimulates adrenocorticotropic hormone (ACTH) release. UI is involved in the adaptability of fishes regarding, for example, ion and fluid equilibrium, cardiovascular activity, and inter-renal tissue glucocorticoid release.Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor.
| Appearance | N/A | 
|---|---|
| Molecular weight | N/A | 
| Purity | >95% | 
| Solubility | Soluble in water | 
| Cas | 83930-33-0 | 
| Sequence | H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 / NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 | 
| C Terminal | NH2 | 
| Storage | -20℃,protected from light and moisture | 
| Transportation | 4-25℃ temperature for up to 2 weeks | 
| Stability | 1 year | 
Document
							Related Product
							
						
 Items-$0.00
Items-$0.00

 Email:
Email: Tel.:
Tel.: MSDS     of     Urotensin I
MSDS     of     Urotensin I   RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                    RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                 Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
                    Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China 
                 Tel:  02988811435
                    Tel:  02988811435
                 Fax: (86-29)8881-1435
                    Fax: (86-29)8881-1435
                 Email: sales@ruixibiotech.com
                    Email: sales@ruixibiotech.com
                 Web: http://www.ruixibiotech.com
                    Web: http://www.ruixibiotech.com    
					
							
                

