Ucn III,cas:357952-10-4
Urocortin III
Product description
Urocortin-3 is a protein that in humans is encoded by the UCN3 gene.It belongs to the corticotropin-releasing hormone family.Urocortin III decreases food intake and delays gastric emptying activity. Stresscopin is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2), therefore acts as the endogenous ligand for maintaining homeostasis after stress. Urocortin III corresponds to Stresscopin .
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | N/A |
Cas | 357952-10-4 |
Synonyms | Urocortin-3; Ucn III (mouse); UCN3; |
Sequence | Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 /FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH₂ |
C Terminal | NH2 |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product