X
Email:
sales@ruixibiotech.com

Ucn III,cas:357952-10-4

Urocortin III

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-276 1mg 420.00
- +
+ Add to cart

Product description

Urocortin-3 is a protein that in humans is encoded by the UCN3 gene.It belongs to the corticotropin-releasing hormone family.Urocortin III decreases food intake and delays gastric emptying activity. Stresscopin is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2), therefore acts as the endogenous ligand for maintaining homeostasis after stress. Urocortin III corresponds to Stresscopin .


Appearance N/A
Molecular weight N/A
Purity >95%
Solubility N/A
Cas 357952-10-4
Synonyms Urocortin-3; Ucn III (mouse); UCN3;
Sequence Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 /FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH₂
C Terminal NH2
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product