SDF-1α (human) trifluoroacetate salt,CAS:1268129-65-2
SDF-1α (human) trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1158 | 10ug | 160.00 | + Add to cart |
|
R-M-1158 | 50ug | 660.00 | + Add to cart |
|
|
Product description
Synthetically produced, contains BSA (low levels of endotoxins) in a ratio of 1:50. Multifunctional cytokine that signals through CXCR4. SDF-1α is involved in several pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. SDF-1α-dependent internalization of the CXCR4 HIV coreceptor contributes to inhibition of HIV replication.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1268129-65-2 |
Sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Synonyms | Stromal Cell-Derived Factor-1α (human) |
Molecular Formula | C₃₅₆H₅₇₈N₁₀₆O₉₃S₄ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product