X
Email:
sales@ruixibiotech.com

SDF-1β (human) trifluoroacetate salt ,CAS:1927911-05-4

SDF-1β (human) trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1159 10ug 155.00
- +
+ Add to cart

Product description

Synthetically produced, contains BSA (low levels of endotoxins) in a ratio of 1:50. CXC chemokine that signals through the CXCR4 receptor and plays critical roles in migration, proliferation and differentiation of leukocytes. Since SDF-1 is involved in several problematic diseases such as AIDS, cancer cell metastasis, leukemia cell progression, rheumatoid arthritis and pulmonary fibrosis CXCR4 represents a therapeutic target for these conditions.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 1927911-05-4
Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Synonyms Stromal Cell-Derived Factor-1β (human)
Molecular Formula  C₃₈₂H₆₂₀N₁₁₄O₉₇S₅
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product