SDF-1β (human) trifluoroacetate salt ,CAS:1927911-05-4
SDF-1β (human) trifluoroacetate salt
Product description
Synthetically produced, contains BSA (low levels of endotoxins) in a ratio of 1:50. CXC chemokine that signals through the CXCR4 receptor and plays critical roles in migration, proliferation and differentiation of leukocytes. Since SDF-1 is involved in several problematic diseases such as AIDS, cancer cell metastasis, leukemia cell progression, rheumatoid arthritis and pulmonary fibrosis CXCR4 represents a therapeutic target for these conditions.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1927911-05-4 |
Sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Synonyms | Stromal Cell-Derived Factor-1β (human) |
Molecular Formula | C₃₈₂H₆₂₀N₁₁₄O₉₇S₅ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product