Peptide YY (human) trifluoroacetate salt,CAS:118997-30-1

H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

Product description

Peptide YY has been isolated from human colonic extracts. It is identical in sequence to porcine PYY except for two amino acid replacements.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	118997-30-1
Sequence	YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH₂
Synonyms	PYY (human)
Molecular Formula	C₁₉₄H₂₉₅N₅₅O₅₇
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of Peptide YY (human) trifluoroacetate salt

Related Product

• peptide-yy-3-36-canine-mouse-porcine-rat-trifluoroacetate-salt