X
Email:
sales@ruixibiotech.com

Peptide YY (3-36) (canine, mouse, porcine, rat) trifluoroacetate salt,CAS:126339-09-1

H-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1112 0.5mg 175.00
- +
+ Add to cart
R-M-1112 1mg 315.00
- +
+ Add to cart

Product description

Peptide YY (3-36) and peptide YY are both synthesized by the gastrointestinal tract and released into the circulation after a meal. Peptide YY (3-36) is a Y₂ receptor subtype agonist, whereas peptide YY is non-selective for Y₁ and Y₂ receptor subtypes. It has been suggested that Y₁ and Y₂ receptor subtype binding affinities depend on their secondary and tertiary solution state structures.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 126339-09-1
Sequence AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH₂
Synonyms PYY (3-36) (canine, mouse, porcine, rat)
Molecular Formula  C₁₇₆H₂₇₂N₅₂O₅₄
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product