Home > products > peptide
> synthetic-peptide
> peptide-yy-3-36-canine-mouse-porcine-rat-trifluoroacetate-salt
Peptide YY (3-36) (canine, mouse, porcine, rat) trifluoroacetate salt,CAS:126339-09-1
H-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1112 | 0.5mg | 175.00 | + Add to cart |
|
R-M-1112 | 1mg | 315.00 | + Add to cart |
|
|
Product description
Peptide YY (3-36) and peptide YY are both synthesized by the gastrointestinal tract and released into the circulation after a meal. Peptide YY (3-36) is a Y₂ receptor subtype agonist, whereas peptide YY is non-selective for Y₁ and Y₂ receptor subtypes. It has been suggested that Y₁ and Y₂ receptor subtype binding affinities depend on their secondary and tertiary solution state structures.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 126339-09-1 |
Sequence | AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH₂ |
Synonyms | PYY (3-36) (canine, mouse, porcine, rat) |
Molecular Formula | C₁₇₆H₂₇₂N₅₂O₅₄ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product