Peptide YY (3-36) (human) trifluoroacetate salt,CAS:123583-37-9

H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

Product description

PYY (3-36), a Y2 receptor agonist. PYY (3-36) has a role in longer term regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	123583-37-9
Sequence	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH₂
Molecular Formula	C₁₈₀H₂₇₉N₅₃O₅₄
Synonyms	PYY (3-36) (human)
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of Peptide YY (3-36) (human) trifluoroacetate salt

Related Product

• perisulfakinin