X
Email:
sales@ruixibiotech.com

PACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂ trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1084 0.5mg 315.00
- +
+ Add to cart
R-M-1084 1mg 545.00
- +
+ Add to cart

Product description

PACAP-38 and its N-terminal fragment PACAP-27 are neuropeptides originally isolated from ovine hypothalamus, but also found in humans and rats. Both PACAP-27, which shows considerable homology with vasoactive intestinal polypeptide (VIP), and PACAP-38 stimulate adenylate cyclase much more potently than VIP. 


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 127317-03-7
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
Synonyms Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat), PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)
Molecular Formula  C₁₄₂H₂₂₄N₄₀O₃₉S
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product