X
Email:
sales@ruixibiotech.com

PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt,CAS:124123-15-5

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1085 0.5mg 320.00
- +
+ Add to cart
R-M-1085 1mg 575.00
- +
+ Add to cart

Product description

PAC1 agonists PACAP-27 (H-1172) and PACAP-38 strongly increased the activity of α-secretase. Upregulation of this APP-degrading enzyme promotes the non-amyloidogenic processing of APP, i.e. reduces the production of Aβ40/42, and thus may help to prevent Alzheimers disease. Nasally applied PACAP-38 in APP[V717I]-transgenic mice additionally enhanced the production of the Aβ-degrading enzyme neprilysin via induction of somatostatin.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 124123-15-5
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Synonyms Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP (1-38), human, ovine, rat
Molecular Formula  C₂₀₃H₃₃₁N₆₃O₅₃S
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product