Home > products > peptide
> synthetic-peptide
> pacap-38-human-mouse-ovine-porcine-rat-trifluoroacetate-salt
PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt,CAS:124123-15-5
H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1085 | 0.5mg | 320.00 | + Add to cart |
|
R-M-1085 | 1mg | 575.00 | + Add to cart |
|
|
Product description
PAC1 agonists PACAP-27 (H-1172) and PACAP-38 strongly increased the activity of α-secretase. Upregulation of this APP-degrading enzyme promotes the non-amyloidogenic processing of APP, i.e. reduces the production of Aβ40/42, and thus may help to prevent Alzheimer’s disease. Nasally applied PACAP-38 in APP[V717I]-transgenic mice additionally enhanced the production of the Aβ-degrading enzyme neprilysin via induction of somatostatin.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 124123-15-5 |
Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂ |
Synonyms | Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP (1-38), human, ovine, rat |
Molecular Formula | C₂₀₃H₃₃₁N₆₃O₅₃S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product