X
Email:
sales@ruixibiotech.com

GHRF Peptide (Mouse)

growth hormone-releasing factor Peptide (Mouse)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1353 0.5mg 200.00
- +
+ Add to cart
R-M-1353 1mg 335.00
- +
+ Add to cart

Product description

The growth hormone-releasing factor (GHRF) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Synonyms Somatoliberin; growth hormone-releasing factor; GRF; growth hormone-releasing hormone; GHRH; somatocrinin; somatorelin; sermorelin; GHRF
Sequence H-His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OH or H-HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS-OH
Molecular Formula C220H365N69O64S1
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product