X
Email:
sales@ruixibiotech.com

GHRF Peptide (Bovine),CAS: 88894-91-1

growth hormone-releasing factor Peptide (Bovine)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1354 0.5mg 235.00
- +
+ Add to cart
R-M-1354 1mg 390.00
- +
+ Add to cart

Product description

The growth hormone-releasing factor (GHRF) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 88894-91-1
Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2 or H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Synonyms Somatoliberin; growth hormone-releasing factor; GRF; growth hormone-releasing hormone; GHRH; somatocrinin; somatorelin; sermorelin; GHRF
Molecular Formula  C220H366N72O66S1
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product