EXENDIN-4,Cas:141758-74-9
EXENDIN-4
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1499 | 1mg | 450.00 | + Add to cart |
|
R-M-1499 | 2.5mg | 900.00 | + Add to cart |
|
|
Product description
Exendin-4 is an analog of glucagon-like peptide 1 (GLP-1);it acts as an agonist at GLP-1 receptors. Exendin-4 exhibits cardioprotective, anti-inflammatory, and antioxidative activities. In mesangial cells, exendin-4 increases phosphorylation of AMPK and decreases phosphorylation of ERK, inhibiting fibronectin secretion and cell proliferation.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 141758-74-9 |
Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2/HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
Molecular Formula | C184H282N50O60S |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product