EXENDIN-4,Cas:141758-74-9
EXENDIN-4
						| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product | 
|---|---|---|---|---|
| R-M-1499 | 1mg | 450.00 | + Add to cart  | 
																					|
| R-M-1499 | 2.5mg | 900.00 | + Add to cart  | 
																					|
| 
										 | 
								||||
Product description
							Exendin-4 is an analog of glucagon-like peptide 1 (GLP-1);it acts as an agonist at GLP-1 receptors. Exendin-4 exhibits cardioprotective, anti-inflammatory, and antioxidative activities. In mesangial cells, exendin-4 increases phosphorylation of AMPK and decreases phosphorylation of ERK, inhibiting fibronectin secretion and cell proliferation.
| Appearance | N/A | 
|---|---|
| Molecular weight | N/A | 
| Purity | >90% | 
| Solubility | N/A | 
| Cas | 141758-74-9 | 
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2/HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | 
| Molecular Formula | C184H282N50O60S | 
| Storage | -20℃,protected from light and moisture | 
| Transportation | 4-25℃ temperature for up to 2 weeks | 
| Stability | 1 year | 
Document
							Related Product
							
						
Items-$0.00

Email:
Tel.:
msds      of      EXENDIN-4 
                    RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                
                    Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China 
                
                    Tel:  02988811435
                
                    Fax: (86-29)8881-1435
                
                    Email: sales@ruixibiotech.com
                
                    Web: http://www.ruixibiotech.com    
					
							
                

