GIP, HUMAN,Cas:100040-31-1
GASTRIC INHIBITORY PEPTIDE, HUMAN
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1500 | 1mg | 265.00 | + Add to cart |
|
R-M-1500 | 2.5mg | 485.00 | + Add to cart |
|
|
Product description
Gastric inhibitory peptide (GIP) is an endogenous peptide hormone analog of somatostatin that is involved in insulin signaling. GIP is secreted in response to food intake and enhances insulin secretion from pancreatic β-cells. GIP also increases plasma membrane translocation of GLUT4 in a cAMP/PKA/PI3K-dependent manner. GIP binds and activates GIP receptors.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 100040-31-1 |
Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln/YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Molecular Formula | C226H338N60O66S |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product