Cecropin B Peptide,CAS:80451-05-4
Cecropin B Peptide
Product description
Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.Cecropins have lytic and antibacterial activities against several Gram-positive and Gram-negative bacteria by forming membrane channels.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 80451-05-4 |
Synonyms | Cecropin-B; Immune protein P9 |
Sequence | H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 or H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
Molecular Formula | C176H302N52O41S1 |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product