X
Email:
sales@ruixibiotech.com

Cecropin B Peptide,CAS:80451-05-4

Cecropin B Peptide

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1417 1mg 150.00
- +
+ Add to cart

Product description

Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.Cecropins have lytic and antibacterial activities against several Gram-positive and Gram-negative bacteria by forming membrane channels. 


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 80451-05-4
Synonyms Cecropin-B; Immune protein P9
Sequence H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 or H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Molecular Formula  C176H302N52O41S1
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product