Cecropin A Peptide

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-1418	1mg	360.00	- +	+ Add to cart

Product description

Cecropins have lytic and antibacterial activities against several Gram-positive and Gram-negative bacteria by forming membrane channels. Cecropin A is a 37-aa antibacterial peptide from the giant silkmoth, Hyalophora cecropia.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Sequence	H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys- NH2 or H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Molecular Formula	C184H312N52O47
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of Cecropin A Peptide