Cecropin B (free acid) trifluoroacetate salt
H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-OH trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-772 | 1mg | 180.00 | + Add to cart |
|
R-M-772 | 5mg | 859.00 | + Add to cart |
|
|
Product description
Cecropin B (free acid) trifluoroacetate salt ,CAS : 203265-23-0 from ruixi.It can be used Antimicrobial & Antiviral Peptides.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 203265-23-0 |
Sequence | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL |
Synonyms | Cecropin B, free acid |
Molecular Formula | C₁₇₆H₃₀₁N₅₁O₄₂S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product