Amyloid β-Protein (1-39) trifluoroacetate salt

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-OH trifluoroacetate salt

Product description

Amyloid β-Protein (1-39) trifluoroacetate salt,CAS: 115427-62-8 from ruixi.It can be used Alzheimer Disease.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	115427-62-8
Sequence	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Molecular Formula	C₁₈₉H₂₈₆N₅₂O₅₇S
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Amyloid β-Protein (1-39) trifluoroacetate salt

Related Product

• granuliberin-r-trifluoroacetate-salt