Big Endothelin-2 (human) ammonium acetate salt
Big Endothelin-2 (human) ammonium acetate salt
Product description
Big Endothelin-2 (human) ammonium acetate salt,CAS :151853-67-7 from ruixi.Big Endothelin-2 (human) ammonium acetate salt belongs to endothelin precursor.It can be applied to cardiovascular system & diseases.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 151853-67-7 |
Sequence | CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPR |
Synonyms | Big Endothelin-2 (1-38), human, Big ET-2 (1-38) (human) |
Molecular Formula | C₁₉₄H₂₈₁N₄₉O₅₇S₄ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product