Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-840	0.1mg	180.00	- +	+ Add to cart

Product description

Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt,CAS : 133551-97-0 from ruixi.Human big endothelin-3 increased arterial pressure, although with less potency and efficacy compared with Big ET-1.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	133551-97-0
Sequence	CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH₂
Transportation	Big ET-3 (1-41) amide (human), Big Endothelin-3 (1-41), amide, human
Molecular Formula	C₂₂₃H₃₂₂N₅₆O₆₃S₄
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document