Big Endothelin-1 (rat) trifluoroacetate salt,CAS : 2243219-82-9
Big Endothelin-1 (rat) trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-838 | 0.1mg | 170.00 | + Add to cart |
|
R-M-838 | 0.5mg | 530.00 | + Add to cart |
|
|
Product description
Big endothelin-1 (rat) trifluoroacetate salt belongs to endothelin precursor.It can be applied to cardiovascular system & diseases.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 2243219-82-9 |
Sequence | CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS |
Molecular Formula | C₁₉₂H₂₉₂N₅₀O₅₈S₅ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product